MZ@ !L!This program cannot be run in DOS mode. $4Pp1vp1vp1v.e1vdt1v7pq1vRichp1vPELţ_  @@8.text `.rdata, @@.data @.rsrc@8: @@`cGgGf=K;GY^_yWVQ=K;GY^_\WVQExiff~5KGf>IIf>MMF ȃ ff?tOf?1tH =|vGt =_kG5KGF ȃ ff?2t G^G g 5KG>GFȺ ff?tOf?1tH =|vGt =tQ5KGFȃ ff?2t GXw5KGG>tgGcGG-G-G_G-G-=|vGt xvGt:uGkGu*uGkGcGgG&=GeGGaGhaG;vGuFGaGhaG;vGu"GaGhaG蜁;vGeGGaGhaGr;vGwiu>GaGhaGR;vGwIuGaGhaG2;vGw)=Gt xvGuGkGu cGcGgGaÍI:F5:F>t>/tF<u EREEj Ehh4E4E4E\TemBph`uPhQ{Eh{Es=EtjhPEhEjg~j=Et EXE7 E0jjjjjhh E~=ERu==EXujhEhEj}j~jhEh,Ej}j~=EXujhEhEj}j]~jhrEhEj}jC~jhhbj~G==ERujhh$j~ F~ Ej 5 Ej5 Ev+5E}EP}`#G>ht>HuWF<1w{$EGF<9v $EGF<9v $EG)G6>9w'~9w!~9wh$Gf~EG)G )Ga`HO5EGFO %Ga`2Jjh] Ehh2J5GA}=] EWVQ0I2JY^_2Jjh] Ehh2J5G|G0I5GFO %GuGGG=GuGG-1G5G=5Gu =1Gr9G=G5GhG EhG{ G WVQbG±GY^_hGh{RFj@hGhGjz5߱GP{߱G5G;{Ga`GGGGG5G5GhG Eh̡Gz١G G 9GBE 5GEE5EhL EhڡGz G-5Ehf EhGsz G-5Ehm EhGTz G jhEjh̡G5߱GzaÀ=GChc"5JFRyjP,yhd"5JF:yjPyhe"5JF"yjPxhf"5JF yjPxj hEhc"5JFxhE{ E;v EEjhEhd"5JFxhEz 5G;r I EEjhEhe"5JFxhEzu E 9G;v EE5G%EE%9GE;Gw;Gv9GG GGEEEEEEG Ghc"5JFwjPwhd"5JFwjP~whe"5JFwjPfwhf"5JFtwjPNwj hEhf"5JFawEG;Gw;Gv GGG G 9GBE 5GEEG GThyFhf"5JFiwj5Ehc"5JFKwj5Ehd"5JF3wj5Ehe"5JFwÀ=8EChv"5JFsvjPMvhw"5JF[vjP5vhx"5JFCvjPvhy"5JF+vjPvj hEhv"5JFvhE&x E;r EEjhEhw"5JFuhEw 5G;r I EEjhEhx"5JFuhEwu E 9G;v EE5G%EE%9GEH; Gr;Gs/G G5EE5EE5EEGG#hv"5JFtjPthw"5JFtjPthx"5JFtjPthy"5JFtjP~tj hEhy"5JFtED;Gw;GvEGGGGRhyFhy"5JFtEGG; Gw;Gs G GGG 9GBE 5GEEGGQhyFhy"5JFDtj5Ehv"5JF&tj5Ehw"5JFtj5Ehx"5JFsU} jhhusEh#u5sy EfEjjf5Eh5y Es3Pjh 5y ElstE=ERWVQEEY^_hEh#u>shYGuCshGh#ushGh#u shGh#urhGh#urhGh#urhGh#urWVQEEY^_hEh#urhîGurhGh#uxrhGh#ufrhGh#uTrhGh#uBrhGh#u0r} u!5bGPrhIGjrjor~} u9Ef d=#u5bGrhIG(rj-r<} &=RFu5Eu8qup(rE+Eȡ9G=GE%EPhx EhEuq 1G5G5E5iEE5ERPh| EhE5q X5*ERPh| Eh Eq XPh| EhEq =E0uE = E0u f E  E:= E0u E = E0u f E  E:=-Gu=)Guf*9G=G%&E` -G)GfEajjf5Eh5y E phEh#u phEh#uo1G5G#MhyFh#uo9G=GMhyFh#uoGGLhyFh#uo U@33;wr ;r+@Mu]`kFoFjhoF5kF5Q Epjhh4Vj p2G6GtGfG=6G GzD<t FGGG G󤾨D<t FGGG G=6Gjh:G5D56G5Q EVo5Q EnG G=6G=DE>G>G<t FGGG OG󤾀D<t FGGG oG󤡭GGGGGDGGOGGoGtG=2G5tGhL EhGm G jjjjhBG3pGjjjjhXGjPhG5G p޵Gjjh|Gjj5Gh\G5޵GoGt-58G5tG52G5IGhG5Got==ERuj0hDhDjljMmj0hDh5Djlj3mhG5GhG5G^o=ERujhDhGjTljhDhGj?l5Go5޵Go5GnGjlaU} NEF=ERuihͻFh=ulhFh@u lhFhAukhFh>ukhFh?ukh0FukghFh=ukh;Fh@ukhSFhAukhFh>ukhFh?unkheFuskʼFFFhFh;u9kFFhFh<ukʼF裇huojPj} ujuuW=ERuj0hFhFj)gj0hFhFjgʼFhFh<u:gʼFFF趃 U} =ERuEhFFh!ufhrFh!ufhFh!ufhFufCh\Fh!ufhFh!ufhFh!uvfh3Fu{fj5Fh!uNfj5!Fh!u9fs} u jue`} uNEf uJ=!u7jjh!ureFjjh!u\e!Fju/e ERhJFJFhSKFOKFhRFsYFWVQEdE Y^_WVQE~EY^_WVQmEyEwY^_WVQEdE Y^_WVQE~EY^_WVQnDDY^_WVQɰDD Y^_WVQTLEME MEY^_WVQOE6UE REY^_WVQdEjE jEY^_WVQ vEE V|EY^_WVQ7Ee E EY^_WVQ E!E v!EY^_WVQr"E#E #EY^_WVQ]E^E 1^EY^_WVQf%E&E -&EY^_WVQ8E:E 9EY^_WVQh%jFjhj5BEXhSjFhjh5BEXj5BEXhjFjhjPXhjFhjh5BEXhKkFhjh5BEtXhlFhjh5BEXXhlFhjh5BEWh_oFh8jh85BE"WhmFh:jh:5BEWj5BEVhoFjhj5BEVhoFhjh5BEVhpFjhj5BEVj5BEbVhpFjhjPVhqFhjh5BEnVhRqFhjh5BERVhqFhjh5BE6VhqFhjh5BEVh1rFhjh5BEUh|rFhjh5BEUhrFhjh5BEUj5BE}UhrFjhjPUhsFhU jhU 5BEUh1tFhX jhX 5BEmUhtFh jh 5BEQUhtFh jh 5BE5UhuFh jh 5BEUh4uFh jh 5BETh8vFhV jhV 5BEThuFhW jhW 5BETj5BE|ThCsFjhjPThvFh_ jh_ 5BEThGh` jh` 5BElThVGha jha 5BEPThGhb jhb 5BE4ThGhc jhc 5BEThGhd jhd 5BESh^Ghe jhe 5BESj5BEShvFjhj5BEShQGhjh5BEShGhjh5BEShGhjh5BEfShvFjhj5BEMShpFha jha 5BE1ShgpFhb jhb 5BEShvFjhj5BERhGh jh 5BERhGh jh 5BERhGh jh 5BERhvFjhj5BERhwFh/ jh/ 5BEsRh xFh+ jh+ 5BEWRh:wFh. jh. 5BE;RhhxFh jh 5BERh-yFjhj5BERhPyFh jh 5BEQhyFh, jh, 5BEQE=EaUĴE0EEu@EE5 EEEEEEhu\QٵFhuJQݵFhu8QյFEEhjQEEP?Qh<EuQBEju5BEjh{hj2hh5EhEj4PM Ej5M EQ5M EQh5 EPEEP5E5M EPjjjEP>P tEPPEPOċE` =Ejjjjjhh$ EP9 E=uS59 EP9 E5 E=ERujh$EhEEjOejhEhEjOM>EEjhE5E59 EPjh] EhhO59 EPWVQO EY^_t9=ERujh^Eh{EjLOjhEh Ej4ODEEDDjhE5E59 EPjh] Ehh|O59 EP[jhE5E59 EOjh] EhhlO59 EO 59 EO9 Ea`jjjjjhhfGNfGufG`jhEj$h~gG5fGDO5fGNWVQtE~gGY^_u  E0WVQE~gGY^_u  E1cWVQhE~gGY^_u  E2>WVQE~gGY^_u  E3WVQ\E~gGY^_u  E4WVQֲE~gGY^_u  E5WVQPE~gGY^_u  E6WVQʵE~gGY^_u  E7=ERu,WVQ\hG~gGY^_j4hgGhgGjL*WVQYjG~gGY^_j4hiGhiGjLuj9MfGhfGM EzgGzgG2fG=ERu8WVQdG~gGY^_ E eGjDhdGhLdGjL6WVQfG~gGY^_ E2fGjDh`eGheGjKtfGhfGeLgGgG2)hyFh 5fGKgGgG7gG;gG  EB3gG  E/gG+gGj5+gGh 5fGKj5/gGh 5fGnKj53gGh 5fGVKgGgG(hyFh 5fG7KgGgGKgGOgG  EBGgG  ECgG?gGj5?gGh 5fGJj5CgGh 5fGJj5GgGh 5fGJKgG+7gGOgG;gGSgGSgG'hyFh 5fGpJgG eGfyFhyFh 5fGDJh 5fGIjP~Ia`=E?="E@E"E"E:5 EE;D=EMRF"Ef«Ff"ED+EޫFFFBFBFЫF\WVQ"EЫF Y^_ޫF5E`PhG EhЫFI aWVQ"EЫF Y^_`PhG EhЫF[I aWVQ"EګFY^_E;DwdD+E`PhG EhЫF I aWVQ"EӫF Y^_tf#E+1f#E+0WVQ"EE Y^_=E2īF"EfȫFf"ED+EFޫF5ޫFhG EhЫFfH WVQ"EЫF Y^_EEE)FxrF5E`PhG EhЫFH aWVQ"EЫF Y^_`PhG EhЫFG aWVQ"EګFY^_WVQ"EE Y^_WVQ"EEY^_ʫF"EfΫFf"ED+EFޫF5ޫFhG EhЫFNG WVQ"EЫF Y^_9% 5aEEEE)FxrF5E`PhG EhЫFF aWVQ"EЫF Y^_`PhG EhЫFF aWVQ"EګFY^_WVQ"EE Y^_WVQ"EEY^_sWVQ"EE Y^_WVQ"EE Y^_WVQ"EE Y^_WVQ"EEY^_WVQ"EE Y^_a`lOaàF: EF: E_ E +=_ EHt =_ Eu{jjjjjhh EE Ejh] EhhlO5 EE5 EPE=lOFomSt%=lOFomstbnOf=nOUuU} 4E$,= E=P= E0FE$,<= E=P= E0F=ERu3hFuDhFhu[DhFhuID1hFuLDhFhu(DhFhuD E0fthuhCjPBC E1@thuBCjPC E2thuCjPB E3thuBjPB E4thuBjPB E5thuBjPB E6thuBjP^B E7\thu^BjP8B } uju)B} Ef = E0huAjjhPnB< E1huAjjhPCB< E2huAjjhPB< E3hu~AjjhPA< E4huSAjjhPA<tu E5hu,AjjhPA<tN E6huAjjhPtA<t' E7hu@jjhPMA<t]=ERuj4hFhFj@j4hDFhaFj@t"hEhUEjjjjjjhߥEjLAjuL@=u ju9@ `jjjjjhh E@ Ejh] EhhlO5 E_A> EEjhE5E5 E9Ajh] EhhlO5 E;AEEjhE5E5 E@lOFomSlOoft WVQ^nOF@Y^_WVQnOEY^_WVQpOEY^_WVQrOEY^_jh] EhhlO5 E@5 E?a_ E %=_ EHt =_ Ejjjjjhh E? Eyjh] EhhlO5 E?5 ED?=lOFomSt =lOFomsu"bnO=bnOuf=nOUuU} =ERu3hIFu>h Fhu>h)Fhu>1hjFu>hUFhuc>hFhuQ> E0thu=jP}= E1thu}=jPW= E2thuW=jP1= E3Ythu1=jP = E43thu =jP< E5 thu<jP< E6thu<jP< E7thu<jPs< } ujud<} Ef = E0hu:<jjhP<< E1hu<jjhP~<< E2hu;jjhPS<< E3hu;jjhP(<< E4hu;jjhP;<tu E5hug;jjhP;<tN E6hu@;jjhP;<t' E7hu;jjhP;<t]=ERuj4hFhFj3;j4hDFhaFj;t"hEhUEjjjjjjhߥEj;ju:=u jut: jjjjjhh E1; E> EEjhE5E5 E;jh] EhhlO5 Ei;EEjhE5E5 EI;jh] EhhlO5 EK;5 Ez:hU%5E9jP}9hW%5E9jPe9hY%5Es9jPM9h[%5E[9jP59hR%5EC9jP9hS%5E+9jP9h;%5E9jP8j5Eh;%5E}9U} ~ELEE E0=E0uW5 EE5 EE5 EE5 EE5 EE5 EEjh>%u8hEh>%u8=E.uh>%u?8jP8 E1 =E1uW5 EE5 EE5 EE5 EE5 EE5 EEjh?%uk7hEh?%uI8=E.uh?%u7jP}7 E2o=E2uW5 EE5 EE5 EE5 EE5 EE5 EEjh@%u6hEh@%u7=E.uh@%u7jP6 E3=E3uW5 EE5 EE5 EE5 EE5 EE5 EEjhA%u36hEhA%u7=E.uhA%uk6jPE6 E47=E4uW5 EE5 EE5 EE5 EE5 EE5 EEjhB%u5hEhB%uu6=E.uhB%u5jP5 E5=E5uW5 EE5 EE5 EE5 EE5 EE5 EEjhC%u4hEhC%u5=E.uhC%u35jP 5 E6=E6uW5 EE5 EE5 EE5 EE5 EE5 EEjhD%u_4hEhD%u=5=E.uhD%u4jPq4 E7c=E7uW5 EE5 EE5 EE5 EE5 EE5 EEjhE%u3hEhE%u4=E.uhE%u3jP3jhF%u3=EMujh)%uj3)=E2ujh*%uP3jh+%u?3=E?hF%u3jP_3hG%up3jPJ3h)%u[3jP53h*%uF3jP 3h+%u13jP 3hb%5E3jP2hX%5E3jP2h%u2jP2ENDU5>Fh'%5EO3END05>FhO%5E*3hEh/%5E3hEh2%5E3hEh5%5E2hEh9%5E2hEh.%5E2hEh1%5E2hEh4%5E2hEh7%5E2hEh-%5Em2hEh;%5EX2hEhO%5EC2hEhI%5E.2hEhK%5E2hEhM%5E2jh)%5E1jh*%5E0jh+%5E0} uju 1} Ef =%jjh;%u0Ejjh-%u0EE5 Ejjjjjhh$ Et19 EE%EE%aEEEE%aEEjhE5E59 E1jh] EhhlO59 E159 E09 E/zF zF5E E`E,aI|FEE>tY%EEE EF%EEEEEGEGE@E jhh5F/ju:/=b%u&jh?h5F/ju /=X%u&jh>h5Fb/ju.=%u Q=F%u~EcT{=G%u~ElwTc=>%ul`E0 E0w5 EE5 EE5 EE5 EE5 EE5 EE a=?%ul`E1 E15 EE5 EE5 EE5 EE5 EE5 EE- a}=@%ul`E2 E25 EE5 EE5 EE5 EE5 EE5 EE a =A%ul`E3 E35 EE5 EE5 EE5 EE5 EE5 EEG a=B%ul`E4 E45 EE5 EE5 EE5 EE5 EE5 EE' a$=C%ul`E5 E585 EE5 EE5 EE5 EE5 EE5 EEa a=D%ul`E6 E65 EE5 EE5 EE5 EE5 EE5 EEA a>=E%ul`E7 E7R5 EE5 EE5 EE5 EE5 EE5 EE{a=)%EMj hEh-%u+hE-u)www Ej5Eh-%u%+j hEh;%u*hE,Ej5Eh;%u*=*%E2j hEh.%uD*hER,u5w)ww w @Ej5Eh.%u]*j hEh1%u)hE+Ej hEh4%u)hE+Ej hEh7%u)hE+Ej5Eh.%u)=+%E6j hEh/%u6)hED+u5w)ww w @Ej5Eh/%uO)j hEh2%u(hE*Ej hEh5%u(hE*Ej hEh9%uw(hE*Eh-%uO( hI%5E+(jP(hK%5E(jP'hM%5E'jP'hO%5E'jP'hF%5E'jP'hG%5E'jP'h%5E'jPt'hF%5E'jP\'hG%5Ej'jPD'h'%5ER'jP,'hO%5E:'jP'U} =ERhDh u'hDh u'hDh! un'hDh" u\'hMDh# uJ'hLDh$ u8'hDh% u&'h{Dh& u'hDh' u'h_Dh( u&hDh) u&hDh, u&hDh+ u&hGu&hlDh u&h{Dh u&hDh! ur&hDh" u`&hDh# uN&hDh$ u<&hUDh% u*&hDh& u&htDh' u&hDh( u%h`Dh) u%hDh, u%hIDh+ u%hGu%} u j&} Ef = uju$p=+ ej(hzDh u$rȾzD1E<8tFE=ERuj0hIDhDj$j0h^DhDj$jh u$j;hDh uG$r ȾD>@tFȾD>.tHF=ERuj0hIDhpDjH$j0h^DhDj3$jh uf$khhDh* u#rȾD1E<8tFE=ERuj0hIDhDj#j0h^DhbDj#jh* u#jhjjjhhG$u==ERujh GhGjc#j$jh Gh GjI#j#Q EkFoFjhoF5kF5Q E1$=@TrC=ERujhGDhDj"jhlDhDj"5Q EF#jo#D訳j^# =~ECt=~ELtG螴Uĸ} zEF޻DhEh#hujhPi!`EhEjh5`EU"hEjh5`E>"hEjh5`E'"hE"EEEEEEEEEE5E5E5E5E5EhR!Fh F! F h`uPh%"h5 EC!k Fh5 E.!Gu EhӤE5E"5Eu:!EEEEhEuM 5E5E!EEӤE E E7V=E.t='E(E)E*E+E,E-E.E1 E6=E.t='E(E)E*E+E,E-E.E E5=E.t='E(E)E*E+E,E-E.E E4`t='E(E)E*E+E,E-E.EB E3=E.t='E(E)E*E+E,E-E.E E2=E.t='E(E)E*E+E,E-E.E E1q=E.t:'E(E)E*E+E,E-E.EO E0"=E.t:'E(E)E*E+E,E-E.E5 EEE E EH=ERtjh 5BEjh 5BE} u0=Et"Ett RE SE鴐} X=E5=1EHt=1EPE%'&7(Uu=Et:<|OEZ=EE7EЊ<=JEtRNE@| <@| $ º|OEJE=E4E)JE@| NE JEE EJEE=EJEE-EJEE=EuRE=SEa=TEt TELTE@SE4JE!E%+'&(=Eu< =Eu< o<0<9 E EPE^~OXEh E<=Eu=wBaBX=Eu=wB@B7=Eu)=wBJ? BfJ=Eu)=wBJ? BfJ=Eu@r?J B=Eu@r?J B=EuB|=E uB kfE=E EE=EE Er E=EucEWE=EuHE< E=Eu-E E=EuEE EEEE=EtK=EtB=EtE=Et<=Et?=Et6=Et9=Et0E 2E&EEEjju3TO} Q=1EZQEPu7F57FE5k Fuh'Fuh jju53F5/Fjj57F7uMh'Fur{Eh{EE EEh'Fu@'F+F4jh'Fj5OKF57F'F +FTjh'Fj5sYF57F'F+F3dddP57Fjh'Fjh.E57FhFEjjjjjjjjhjjj j;P57FeE3P57F]'F@+Fjh'Fj5JF57Fu57FEPujjj5`EhujhPh`EhEjh5`EThEjh5`E=hEjh5`E&Njjj5`EEPu 7FhFEj@jjjjjjjhXjjjjP57F:E=1Eh'Fu%3ڰP57F 'F +F jh'FhxhmE57F3P57F'F +F:jh'FhxhE57Fy+Fjh'FhxhۭE57FS+Fjh'FhxhϰE57F-+FZjh'FhxhóE57F3ڰP57F 'F +Fjjh'FhxhaE57F+Fjh'FhxhUE57F+F*jh'FhxhIE57Ft+Fjh'Fhxh=E57FNjj j 57FMj ho57F5hho57F hj 57Fj j 57Fjj9j 57Fj9ho57Fjj hO57FhhO57Fjj:h57Fhh57Fjj:h57F|hh57Fajj:h[57FShh[57F8jj:h57F*hh57Fjj:h57Fhh57Fjjj57Fjhq57Fhhq57Fhj57Fjj57Fu57FEPuJ=1EH_ h'Fuh3dddP57F['F+F jh'Fjh=$E57F'F+F jh'Fjh7E57Fjjj57Fjj&57Fjjh57Fjh57Fjkh57Fjkj57F|jj57Fm= !E:'F+Frjh'Fjh E57F)jjzj57F(jzj57Fjjzh57Fjzh57Fhh57Fhj57Fjzj57F="E@=E?E"E'F+Fjh'Fjhr"E57FTjhj57FPhj57F8jhh57F'hh57F h,h57Fh,j57Fhj57F'F+F^jh'Fjhf%E57F'F+Fjh'Fjh"(E57Fo'F+F3P57Fl3P57FIjh'Fjh(E57F=3EWu=3EDu7'F?+F3P57F3P57Fjh'Fjh/E57F 3PjjeP57Fjjh57Fojh557FWhh557FBhh57F-jh57Fjjh=57F jh57Fhh57Fhh=57Fjh=57F=E}/33PjjnP57F=Ejjh57Fkjh557FShh557F>hh57F)jh57F33Pjj P57FE*E.E.E=.E|E"E*EE&Ej5E5E57F 5E5"E57Fd 5&E5"E57FM 5&E5E57F6  E5E5E57F =JE33P57F E'FE+F33P57F 3P57F jh'FjhNE57F `jjh<57F jh57Fi hh57FT hh=57F? jh=57F- 33Pjj P57F EBEFEFEF=FE|2E:EBE6E >Ej56E52E57F 56E5:E57Fz 5>E5:E57Fc 5>E52E57FL  6E56E52E57F/ 3P57F* 33P57F 'F+F jh'FjhGE57F'F+Frjh'Fjh !E57F'F+F="E@t1=E?t(E8"Eujh'Fjh"E57FO=fDfA3P57FS 'F+F@jh'FjhɰD57FA=1EP 葰h'Fu3dddP57F 'F(+Fjh'Fjh7E57Fjhj$57F hj:57Fy jhh57Fh hh57FM hh57F8 hj$57F& hj$57F = !E:'F+Fjh'Fjh E57Fjhh57Fhh57Fjhh57Fhh57Fh h57Fmh h57FXhh57FC'F(+F jh'Fjh$E57F 'F&+F jh'Fjhf%E57F="E@=E?E8"E'F+Fjh'Fjhr"E57Fjhh57F~hh57FcjhhO57FRhhV57F7hhV57F"hh57F hh57F'F-+F3P57F3P57Fjh'Fjh8E57F'FP+F ==Et ==EHjh'Fjhjh'FjhbE57F2jh-j;57F.h-h57Fhh57Fhj;57Fh-j;57Fjh=j;57Fh=h57Fjh+j957Fh+h57Fhh57Fshj957Fah+j957FOd%=1EN h'FuD3dddP57F7'F+F jh'Fjh7E57Fjjj57Fjj&57Fjjh57Fjh57Fjih57Fjij57Fjj57Fv= !E:'F+Frjh'Fjh E57F2jjzj57F1jzj57Fjjzh57Fjzh57Fhh57Fhj57Fjzj57F=E?="E@E8"E'F+Fjh'Fjhr"E57F\jhj57FXhj57F@jhh57F/hh57Fh8h57Fh8j57Fhj57F'F+Fjh'Fjhf%E57FQRVlO:EalODEMlOdE9lOzE%lOElOElOElOʊEծlO܊ElOE譮lOE虮lOE腮lO(EqlO[fu Ifu 7E`5‹E5EhG EhƋEraVWQ΋EY_^E=Eu EeY_^h'FuU3dddP57FH'F(+Fjh'Fjh7E57Fjhj$57Fhj:57Fjhh57Fhh57Fhh57Fhj$57Fhj$57Fr= !E:'F+Fjh'Fjh E57F.jhh57F'hh57F jhh57Fhh57Fhh57Fhh57Fhh57F'F+Fjh'Fjh$E57Fj'F&+Fjh'Fjhf%E57F=3P57FB33P57F7'F+Fjh'FjhGE57F'Fn+Fjh'Fjh !E57F3P57F3P57F'F#+F#jh'FjhE57FZjj#j#57FYj#h57FAh"h57F,h"j#57Fj#j#57F =fD 3P57F'F(+Fjh'FjhɰD57F =1EFVWQlOEE=u G < GEOF>=u G < GBEG>cu G < GBEG>Hu 7E`5‹E5EhG EhƋEaVWQ ȋEY_^ E=Eu E3Y_^h'Fu3dddP57F'F(+Fjh'Fjh7E57F`jhj$57F\hj:57FDjhh57F3hh57Fhh57Fhj$57Fhj$57F= !E:'F+Fjh'Fjh E57Fjhh57Fhh57Fyjhh57Fhhh57FMhh57F8hh57F#hh57F'F+Fjh'Fjh$E57F'F&+Fjh'Fjhf%E57F'F +Fjh'FjhE57F}3P57F3P57Fk'F#+F#jh'FjhE57F"jj#j#57F!j#h57F h"h57Fh"j#57Fj#j#57F3P57F33P57F'F+Fjh'FjhGE57Fn'Fn+Fjh'Fjh !E57FA=fDX3P57FE'F(+Fjh'FjhɰD57F=1ED%`EQ`EYa`lOE~ up贌 bah'Fu3dddP57F'F(+Fjh'Fjh7E57FBjhj$57F>hj:57F&jhh57Fhh57Fhh57Fhj$57Fhj$57F= !E:'F+Fjh'Fjh E57F}jhh57Fvhh57F[jhh57FJhh57F/hh57Fhh57Fhh57F'F+Fjh'Fjh$E57F'F&+Fjh'Fjhf%E57F'F+F'F +Fjh'Fjh0E57FK3P57F\3P57F9'F#+F#jh'FjhE57Fjj#j#57Fj#h57Fh"h57Fh"j#57Fj#j#57F3P57F33P57F'F+Fjh'FjhGE57F<'Fn+Fjh'Fjh !E57F=fD&3P57F'F(+Fjh'FjhɰD57F=1EGh'Fu3dddP57F'F(+Fjh'Fjh7E57FYjhj$57FUhj:57F=jhh57F,hh57Fhh57Fhj$57Fhj$57F= !E:'F+Fjh'Fjh E57Fjhh57Fhh57Frjhh57Fahh57FFh h57F1h h57Fhh57F'F(+F jh'Fjh$E57F'F&+F 'F&+F jh'Fjhf%E57F'F+Fjh'FjhyFE57Fbjhh57F[hh257F@hch257F+hch57Fhh57Fjhh57Fhh257Fjhh57Fhh57Fjhho57Fhho57F}jhh57Flhh57FQjhh57F@hh557F%hfh557Fhfh57Fhh57Fu57FEPu*:} u j?:} 9=JFt苆jjuJFEf= ujjjh%Ejj99f=. ujjjhVEjj99f=/ ujjjh|Ejjf9x9f= u0RFDSjh3DCuh%D5 EB9f= u0RFDKjh3DCuh+D5 E 9f= u0RFDCjh3DCuh1D5 E[8f=f^EPP=1EZuVEEhEu-E-E)jhSh5E5Eu1EHjhBuhE5 Ejju98f=EEhEup-E-E)jhSh5E5Eu1EGjhB7CuhE5 E?jju7f=(f^ELSWVQrFdFY^_WVQFFY^_5pEE5tEE5xEE5DE5DEjhCuhE5 E 5 E0FE±FEEEEE/EEhEu$1EH-E-E)jhSh5E5Eujju[|6f=(f^ELCWVQrFkFY^_WVQFFY^_5pEE5tEE5xEE5DE5DEjhCuhE5 Ee 5 E0FE±FEEEEEEEhEu1EH-E-E)jhSh5E5Euqjju)J5f=&5pEE5tEE5xEE5DE5DE5 EEjhqBuhE5 E`=dEtH5EpE5EtE5ExE5ED5EDE5 Ef^ELME&EEhEu-E-E)jhSh5E5EuH1EMjju4f=>5pEE5tEE5xEE5DE5 EEjh uW(f= u8=ERujjjhEjj脴jjjhEjjn(f= u8=ERujjjhEjjFjjjhEjj0'f=+ u8=ERujjjh9EjjjjjhZEjj'f= ujjjh~Ejjӳ~'f= u'hEhUEjjjjjjhEjQ'f= u'hEhUEjjjjjjhEjô$'f= ujjjhƥEjjZ'f= ujjjhѥEjj;&f=u'hEhUEjjjjjjhߥEjX&f=u'hEhUEjjjjjjhEj+&f=ujhCuhE5 Eg&f=ujhDuhE5 EDzB&f=jhCuhE5 E螲H#H H H'H+H+H#H H H/HCjhTCuhD5 E%|ChEjjPjjE%f= un MiR=1EZt5Euײ5EuDzjju7jh 5BEjh 5BEѱu轱,%f= unNQ=1EZt5Euc5EuSjjuñjh 5BEojh 5BE]uI$f=u!`jhBuhED5 Ea$f(u`?DhEjjPjjal$f=) unjh:YAuh2E5 ḚjhjjjhhF辱-Fjh] Eh h9F5-FW5-F膱;p#f=a wp1EEEhEu#-E-E)5E5M Ejhh5E5Eu蘰jjuPjhgCuhkG5 Eܯ=fG?u9=ERujht\Gh\GjA#jh]Gh]Gj)#=fG8r9=ERujhp]Gh\Gj"jh^Gh]Gj"fGaG1cG:zgGt==ERuj1hbGhSaGj譯j1hcGhbGj蘯tj4=h EFlasWVQ~gGh EY^_7gGgG;gGgGKgGgGOgGgGjjjjjhhfG裯fGjhEj$h~gG5fG?5fGn8FD E,Cᣒ>GsP>G:NTFSdsP>G>GqP>G>G>GfG Ejjjjjhh EEE E>G%>G%aEkFoF>G%aEoFjhoF5kF5E E藬jh2DhhlO5E EolOgEyF5aEfGfGfGfGfGfGfGjh'CuhkG5 EOkG=ERu6eGGkGh1Dh5*pGhADh5*pG4kGGkGh9Dh5*pGЪhhDh5*pG軪Q$AhGGjjPjj;FFFjhPA5FhE5 E F=ERuhF5fDWhF5fDE=`FVEfGVEuF5FXBhFjjPjjBfJfGGGhGGhGGhGGhGG5GGGG5aEfGfGfGfGfG =GGGGfGjh'CuhkG5 EokG=ERuMeGGkGh1Dh5*pG&hDh5*pGWVQEEY^_KkGGkGh9Dh5*pG٨hDh5*pGĨWVQEEY^_WBhGGjjPjjDf=( u/jh&HAuh8E5 E褧=uGt7Vf=, u.jh"KAuh$E5 Eo=FGtdf=5EEhEu-E-E)5E5M Ejhh5E5Eu臧jju?1EFFFFjhBuhE5 E谦+f=6EEhEub-E-E)5E5M E?jhh5E5Euצjju菦1E FFAFFjhDBuhE5 E{f=7EEhEu貥-E-E)5E5M E菦jhh5E5Eu'jjuߥ1EwFFFFjhBuhE5 EPfqEEhEu-E-E)5E5M Eߥjhh5E5Euwjju/1EjhZ^@uhE5 E贤/f=81EEEhEu_-E-E)5E5M E<jhh5E5EuԤjju茤jhjjjhh G$$GkF(G-kF}GoFjhoF5kF5$G|jh] EjhG5$GWkF)G-kF}GoFjhoF5kF5$G-jh] EjhG5$GkFpG-kF}GoFjhoF5kF5$Gޤjh] EjhG5$G蹤G֠GGڠGkFG-kF}GoFjhoF5kF5$G{jh] EjhG5$GVWVQGGY^_jjh5$G7jhEhhG5$G5$Gh$GGuGGĠGjjjjjhhdG;yG=jh] Ehh2J5yG蟣WVQG2JY^_uc=ERuj$h[GhGjVj$h,GhGjAujhhu:sh G赢GjhBuh0G5 Ek G< t*G+G:XGYG:5uGh. EhG1 G 5uGh. EhؗG ݗG 5GhB EhG G 5GhB EhGԡ $G hE EEEEEEEEEE5E5E5E5E5EhR!FhGWjhBuh5G5 E&BhEjjPjjFf=u}$`1EEEhEuП-E-E)5E5M E譠jhh5E5EuEjjuf=f^ERSWVQ0F"FY^_WVQeFWFY^_5pEE5tEE5xEE5DEjh+@uhE5 E 5 E0ӁEEhEuȞ1EH-E-E)jh]h5E5EuGjju f=f^ERCWVQ0F)FY^_WVQeF^FY^_5pEE5tEE5xEE5DEjh+@uhE5 E 5 E0ՀEEhEuʝ1EH-E-E)jh]h5E5EuIjju"f=@f^EVS5pEE5tEE5xEE5DEEE5EF5E±F=E2uD5FBD=BDv8jh] Eh5>D5 E踏t?>D-BD뼡BD%aEjh] EP5>D5 EyujjhbAuhE5 E贍/f="u3F5pEE5tEE5xEE5DE5 EEjh Fh u~GG=/GtLh u~jjhP~XGh u}jjhPc~\Gju}hf= ujhkuDuhE5 Ep}f= `WVQE/GY^_hkG}t\uPhE5\uP|EFh u{GFo5>Fh ul{h uzjPz$,CG`pP5G5GGVGpP5G5GGVGGGa=P5GFh uazGFB5>Fh u?zh uyjP|y`=ERuj0hJ'Ghl'Guyj0h'Gh'Guya5`=ERuj0h,(GhO(Guyj0h(Gh(GuxyahEh uyhEh uyhs\Gh uyh uxPvyh uxjPx `G+G@fGfGG1GGG5GGfG 05 Ejjjjjhh$ E y9 EhEyhtGyhGyhG yhGyhGxhGxh5GxhUGxhGx`hExEEEEEEEEEE5E5E5E5E5EhR!FhoG1x5E5E5E5E5EhR!FhGxajhjjjh@hUGwrGjhE5EhmE5rGx5rGwjhjjjh@hGwGkFoFjhoF5kF59 Exjh] Eh~h2J59 EwjhEh~h2J5Gw5G*w=fGt:Yt01G5GGG=EwAE>G<t7FGGA<t!FG=bGtG9Gr5Gv5Gv5Gzv5Gov5QGdv4E~Gjhjjjhh~GJvu8=ERuj0hDhDjuj0h2DhUDjuj1vPuG =GuWVQGEY^_=GuWVQGEY^_=GuWVQGEY^_hEhUEjjjjjjh~GjufGjj'h5Fta`WVQlOhOY^_lO=\GuC=XGu t=\Gu5u8la`G=GtIG%aE2JhO󤡚GGG;Grw IG뫐a`G!G=,G|G-G'8G|5 GhB Eh9GKt DG|5 GhB EhEG,t PG| G+ GC;GrFG5GhGhGs  G|ShB EhQGs f\G bGa`fG]GjjjjjhhYGs`GI|FE E9t)%>GLGA%>GLGxE5`GOs`GfG=ERuj4h>Gh>Gjrj4hAGh8AGjruj1sjjh5FraáLGPGLG%aE>G>Gjh>G5>G5`GYssjh2DhhO5`G,srOOu>jh>G5>G5`G srjh2DhhLG5`GsrfGfG-fGfG PGt LG.UĤ} uz=ERu6hJGhuqhJGhuqhSLGuqhKGhuvqhKGhudqh~LGuiqy} uf?fG=ERuWVQXGXGY^_WVQXGXGY^_hXGjh5`Epju>p} Ef =j hfGhu p%fGߠfG=fGBw8=ERuj0hIGhIGu0pj0hJGh-JGupj E=t& EfG0YGkGkGjuzoG=ERuj0hIGh JGuoj0hJGhJGuohs\Ghuo WVQf Ejjjjjhh EoE E= E E E E E E E E E Ejh Ehh Eh h Eh5E Ewou* ELGf<u u fFGFGjh2Dhh|O5E Eof=|ONTufLGNTfLGFS|O|OJf=|OFAufLGFAfLGT !f=|OFAfLGFAfLGT |O5iE%aE5qE ELG 5 EhX EhLGRn =LGu LG 4=LGu LG "=LGu LG =LGuLG fLG??fLG??5E EmY^_`WVQ~gGh EY^_fGfG7gG;gGgGgGKgGOgGgGgGhfGmjhjjjh@hfGmfGjhEj$h~gG5fGn5fGJm'gGaQRWV=E FEE =EDOC u=E>@=ERTF u=E "=EXLS u=E=EMDB u=E=EPPT u=E=EARJ u=E=ERAR u=E=EZIP u=Eln=EDBX u=ENP=EPST u=E02=EPSD u=E=EAI u=E=ECDR u=E=EDWG u=E=EPLA u=E=EPDF u=E|~=EPGD u=E^`=EZIP u=E@B=EGIF u=E"$=ETIF u= E=EJPG u= E=EAVI u= E=EMP3 u= E=EWAW u= E=ENEF u=Enp=ECR2 u=EPRf Ff9EuF8Eu=E"$f Ff9EuBzF8Eu=Ef Ff9EuBzF8Eu=Ef Ff9EBzF8E=E=Eto=EtZFE"8u AB<u]=EtDzFE"8u AB<u8=EtDzFE"8u AB<u=Eu t^_ZYËjh5BEgjh55BEgjh65BEgjh75BEgjh;5BEngjh85BE\gjh95BEJgjh<5BE8gF5Fm!FRFFFFZE E?5EgEYjh"h5FVgFÐUVEuEP{P{PP^]QRWVF FF^FbF1B6< uIB tASQRVr F Ft ;2t ^ZY[u $OF€ ^Ful^_ZYR! F% F) F- F1 F5 FB: F_FbFz6u : F;B7t!_F€ _F;  Frָ  _F F gFRQ5: Fh2 EhFf YZWVQFF Y^_: FoFQWVbFF "E^_YQ! F% FЏ! F=Q! F% Fz u%F9: Ft! FbFZR! F% F) F- F1 F5 FB: F_FbFz6u : F;B7t_F€ _Fܸ _FQ! F% F! F=N ~ t;~ t5F t/>.t*>u"fFf{PfFf{P5{P D$ D$ |$ vD$ D$D$;oFt*D$%oFGD$Ft$ OD$D$V5G^=s/t*D$%oFGD$Ft$ $$]U($$E$D$D$D$ t$FD$%oFGFt$Z D$ t$>wF ~ >.~ >$$u!F $F$D$ $$=G$f f` a$>$$>t+V F^:$uw`ZFGa${P${P`5{P {P{Pf fZF ={Pua{PfDŽ$[WVZFGZF< t FGAu^f~ t. fFfGF G_|fDŽ$ D$ D$ |$ D$ D$D$;oFt*D$%oFGD$Ft$+ D$D$V5G^=s4uD$@D$%oFGD$Ft$v$$]U} =ERuhFhju-_hBFh@u_hsFh_u_hFh`u^hFhau^hFhbu^hFhcu^hFhdu^hFheu^hFhfu^hFhjut^=ERu*WVQEEY^_hFjj u1^(WVQEEY^_h>Fjj u^jhhu^EhBuc]y E3Pjh 5y E]fEjjf5Eh5y E]C^E} u5E]j]} uLEf =@u/=Eu 5E]5Ev]=Euj]{} e=Fu5Eu\u-\:fEf=Ed~ fEjjf5Eh5y E\`j5EhCu\j5 EhDu\j5EhEu~\j5EhFui\j5GEhGuT\j5KEhHu?\E#E5EjPhIu\EE5EjPhJu[EE5EjPhKu['E+E5EjPhLu[a I|$=x{P5|{PU`=x{PtNFPh: EhF[ F|fFPh& Eh Fo[  F|XG%oFGGFPh: EhF9[ F|G fFPh& Eh F[  F|5|{PfFfFf FF FFFFPh: EhFZ F|FF=x{PFPh6 EhFZ %F||{P&FWVQF&FY^_|{P7FWVQF7FY^_5|{PF tHFFFHF F ~h=ZFu ZFxWVQFZF>Y^_5|{PfFfFfFfFFPh6 EhJFY SF|FjfFftPh. EhTF~Y YF|TF>>>>fXF>|F=HFtHEFEF#EEFEFEGE=`Fu>F>tAFf  \FjhFE5\FhF5EYjhFE5FhF5EjYa]Ð`EG5E=GG.G.G G :FE`5‹E5EhG EhƋEHXafыE=G< u0fGF%E`5‹E5EhG EhƋEXafыE< u0fGF% E`5‹E5EhG EhƋEWaϋE E`5‹E5EhG EhƋEWafыE< u0fG %E`5‹E5EhG EhƋEIWafыE< u0fGaÍIVRQ{P{P{P5Gt:s2u {P! {PA;t{P{P뷉{PYZ^{PU`=uu%aEkFoFjhoF5kF5 ED5FBD=BDv8jh] Eh5>D5 EhUt?>D-BD뼡BD%aEjh] EP5>D5 E)UujTF%oFGPh: EhFWT F|ffFPh& Eh F3T  F|fF f F F F FFFPh6 EhFS %F|WVQJFF Y^_FHFWVQFpFY^_WVQZFpFY^_FF0WVQFFY^_WVQFFY^_WVQ&FFY^_WVQ7FFY^_=`Fu|jhjjjh@hrE SEjhFE5FhsF5ESF>tAFf  \FjhFE5\FhF5EgSjhjjjhhEREjhFE5FhF5E)Sa`0H GGG(G=G oGyG<t FGsGwG G󤾢G<t FGŻGɻG GEGG G=G4G G,G GGmE EļG GoGsGGŻGG@GGGEGG= G5GhL EhG*Q G jjjjhGSGjjjjh(GjPhG5GZSGjh@hGjj5Gh,G5GSGt-5 G5G5 G5GhG5GRt3=ERujhDhUDjOjhްDhDjOmh G5GhG5GR=ERujhGhGjOjh7DhGjO5GhR5G]R5GRRaUĸ} uG=ERuEhGuOh+GhO uqOh>GhQ u_OhLGhS uMOEhGuPOh4GhO u,OhEGhQ uOhvGhS uO>} u jZO,} E=N j(hyGhP u@tFȾG>.t[F=ERuj0h\GhGj|Mj0h GhGjgMjhR uMhR uLPMWVQGE(Y^_GG(<tFGh h,GhT uLGwU=ERuj0h\GhqGjLj0h GhGjLjhT uLhT uRLPL ju(L Uĸ} =ERhhGuLhGh u{Lh@tFȾG>.t`F=ERuj0hGhGj7Dj0hGhGj"Djh uUDjGffPuCP@D juC GGPh" EhG-D WVQ^GGY^_WVQ^GGY^_GGf<fPh* EhGC WVQiGGY^_WVQiGGY^_`0H8G4GG`G=4G GSG<t FGGG G󤾓G<t FGGG MGEGQG G=4G=ERu G uG G uG󤾟G G󤡧GGGGMG@G=ERuuGuGGG=8G5GhL Eh^GB eG jjjjh@GD`GjjjjhXGjPhLG5`GDhGjh@hGjj5dGh\G5hGwDlGt-58G5G58G5GhG5lGKDt3=ERujhDhGjTAjhްDhGj?AmhpG5tGhxG5lGD=ERujhGhxGjAjhcGhxGj@5lGC5hGC5`GCa`0HGGGxG=G G󤾿F<t FGGG GF<t FGGG eGEGmG G=G9F FG bG=G=FF:fG G󤡿GGGGeG@GFbG-GG=G5GhL Eh&G@ -G jjjjhGpBGjjjjhGjPhdG5GFBGjh@hGjj5GhG5G BGt-58G5G5G5aGhG5GAt3=ERujhDhDj>jhްDhDj>mhG5GhG5GA=ERujheGhGj>jh|GhGj>5GTA5GIA5G>AaUĸ} %`kF ? G G3һTMF G GkFAhE>EEEEEEEEEE5E5E5E5E5EhR!FhF >aWVQUFFY^_=ER EGhGu=hGh u=hGh uv=hGh ud=hGh uR=h9Gh u@=hEGh u.=hGh u=hGh u =hGh u<h Gh u<hFGh u<=kFAu_hUGh u<hGh u<hGh u<hGh u<h-Gh uq<hAGh uZ<h|Gh uH<hGh u6<hGh u$<h-Gh u< EGhGu<hwGh u;hGh u;hGh u;hGh u;h1Gh u;h7Gh u;htGh ux;hGh uf;hGh uT;hGh uB;h-Gh u0;=kFAu\h=Gh u;hxGh u;hGh u:hGh u:hGh u:\h)Gh u:hdGh u:hGh u:hGh u:hGh uq:+} u j:} E= j(hFh u9rȾF1E<8tFX=ERuj0hGhGj9j0hGhGGj9jh u9h u)9P9cWVQFE(Y^_FF(<tFGj;hFh u8r ȾF>@tFȾF>.t[F=ERuj0hGhGj8j0hGhGj8jh u9h uf8P8WVQFE(Y^_FF(<tFG=kFAtjjhh u~8uA=ERuWVQFUG:Y^_WVQF=G:Y^_jjhh u"8uA=ERuWVQFG:Y^_uWVQFxG:Y^_Yjjhh u7uA=ERuWVQFG:Y^_WVQFG:Y^_jjhh uj7=ERuWVQFG:Y^_WVQFG:Y^_jjhh u 7uA=ERuWVQFAG:Y^_]WVQF)G:Y^_Ajjhh u6uA=ERuWVQF|G:Y^_WVQFdG:Y^_jjhh uR6uA=ERuWVQFG:Y^_WVQFG:Y^_jjhh u5u;=ERuWVQFG:Y^_LWVQFG:Y^_3=ERuj0hGh)Gjp5ej0hGh^Gj[5P1FoF55F55FkF1 1Ft 5Fju4 =ERuj@hFFhFj4j@hFhZFj4UuE} fE{ F=ERu7hFhAu4hFh@u45Fu4.5Fu4hFhBu4hFhCuq4hFhAu_4h2Fh@uM4hKFhsu;4hSFhtu)4h\Fhuu4hlFhvu4hFhwu3hFhxu3hFhyu3hFhzu3hFh{u3hFh|u3h6Fh}u3hFhuu3=DuHhA5{ F2jP2hB5{ F2jP2hC5{ F2jPv2h5@jh6hE5E2hE5Eh2Ej jjjj1Ej$5 Ex2Ej5E5E15E35EjhhE5Ez2jjjjju1Ej#5 E2Ej5E5EE15E35EjhhE5E2VFZFilhAj[h0hE5E1D^j jjjj0Ej%5 E|1Ej5E5E05E25Ejh hD5E~1hD5E0Ej5EhFuf1j5 EhGuQ1j5EhJu<1j5EhKu'1E#E5EjPhHu1'E+E5EjPhIu0EE5EjPhLu0EE5EjPhMu0jjhNu0jjhOu0jjhPup0jjhQu_0FFjhPAuhE5 ES/mE%EEEE‹EEƋEѭhƋEhTu/qE%EEEE‹EEƋE莭hƋEhUu/FFAho FjjPjj/ } u:=Et5E/Ej5E.E } /Ef o =@u+j5Ek.jh, h5F.=A`F=ERuj$h FFhDF5E}.j$hGFh7FF5Ed.ajjjjjhh$ E.9 E/E3Eu9=ERuj0h Fh Fj.Xj0h.!Fh Fj-@=ERuhFCAhn!FjjPjjI-=BukFFFTF3FFFjhPAuhE5 E+FAhs FjjPjj,p=CuiFFFoF3F FFjhPAuhE5 EG+FVAhs FjjPjjb,Q} N>W}Fw F;EMuh=_Ft =_F u+hAj h05E+W_F hAj h05Ei+W_F uh=cFt =cFu+hAjh05E&+WcF]hAjh05E*UWcF2uh=cFt =cFu+hAjh05E*WcFhAjh05E*VcFuh=cFt =cF u+hAjh05EJ*VcFhAj h05E*yVcF Vuh=cFt =cF*u+hAj)h05E)6VcF)hAj*h05E) VcF*uh=cFt =cF4u+hAj3h05En)UcF3hAj4h05EC)UcF4zuh=cFt =cF>u+hAj=h05E)ZUcF=7hAj>h05E(/UcF> uh=cFt =cFHu+hAjGh05E(TcFGhAjHh05Eg(TcFHuh=cFt =cFRu+hAjQh05E$(~TcFQ[hAjRh05E'STcFR0 &=cFt =cF\u(hAj[h05E' TcF[&hAj\h05E'ScF\u S= F*]{C jFfF0uw FFFFTF3FFFjhPAuhE5 E&FOAhs FjjPjj!'{ C jFfF1uw FFFFTF3FFFjhPAuhE5 Ep%FOAhs FjjPjj&n;Eufnu[fw\ Ffw^ F= F|> Ff>CRhAjh05E%'RcF F_ 3UuE} {E{ F=ERu7hFhAuv%hFh@ud%5Fuh%.5FuU%hFhBu1%hFhCu%hFhAu %h2Fh@u$hKFhsu$hSFhtu$h\Fhuu$hlFhvu$hFhwu$hFhxu$hFhyu}$hFhzuk$hFh{uY$hFh|uG$h6Fh}u5$hFhu#$=DuHhA5{ Fz#jPT#hB5{ Fb#jP<#hC5{ FJ#jP$#h@u5#jP#h5@jh6hE5E#hE5E#Ej jjjjo"Ej$5 E#Ej5E5E?"5E$5EjhhE5E#jjjjj"Ej#5 E"Ej5E5E!5E$5EjhhE5E"VFZFWhAj[h0hE5E}"Nj jjjjs!Ej%5 E"Ej5E5EC!5E#5Ejh hD5E"hD5E!Ej5EhFu!j5 EhGu!j5EhJu!j5EhKu!E#E5EjPhHu!'E+E5EjPhIu~!EE5EjPhLu]!EE5EjPhMuFAhn!FjjPjj=BukFFFTF3FFFjhPAuhE5 ERFAhs FjjPjjmp=CuiFFFoF3F FFjhPAuhE5 EFVAhs FjjPjj} NW}Fw F;EZMuh=_Ft =_F u+hAj h05E-H_F }hAj h05E\H_F Ruh=cFt =cFu+hAjh05EHcFhAjh05EGcFuh=cFt =cFu+hAjh05EQGcFhAjh05E&GcFvuh=cFt =cF u+hAjh05E=GcF3hAj h05EGcF uh=cFt =cF*u+hAj)h05EuFcF)hAj*h05EJFcF*uh=cFt =cF4u+hAj3h05EaFcF3WhAj4h05E6FcF4,uh=cFt =cF>u+hAj=h05EEcF=hAj>h05EnEcF>uh=cFt =cFHu+hAjGh05E+EcFG{hAjHh05EZEcFHPuh=cFt =cFRu+hAjQh05EEcFQ hAjRh05EDcFR =cFt =cF\u(hAj[h05EKDcF[&hAj\h05E#}DcF\s`=Djjh5Ejjh hE5E;F7F?FB FWVQB FE Y^_KFOF `h7FjhhE5Eba B F ?F`h7FjhhE5E"a B FbF`B%aEEEjjjjjhh$ E/9 EjhE5E59 Ejh] EhhlO59 E<- =ERuj@hDhDjLj@h Dh*Dj7aau B= F*]{C jFfF0uw FFFFTF3FFFjhPAuhE5 EFOAhs FjjPjj { C jFfF1uw FFFFTF3FFFjhPAuhE5 EYFOAhs FjjPjjtp;Euhnu]fw\ Ffw^ F= Ft@|> F0*AhAjh05EAcF F_ 3U` F7FFBFCFY^_WVQZBF DF8Y^_.WVQ>BFIDFY^_WVQZBFeDF8Y^_WVQBF=F8Y^_WVQBF=F8Y^_WVQ CF>F8Y^_WVQDCFM>F8Y^_WVQ~CF>F8Y^_j@h>BFhZBFjjhCh5{ FaRVWtFa(aV==BFCFY^_WVQZBF DF8Y^_.WVQ>BFIDFY^_WVQZBFeDF8Y^_WVQBF=F8Y^_WVQBF=F8Y^_WVQ CF>F8Y^_WVQDCFM>F8Y^_WVQ~CF>F8Y^_j@h>BFhZBFj jhCh5{ F aÐ`ƒ\t>/tNF8GWVQ8GEY^_>u4G 4Ga4G`WVQ"FEY^_}WVQ;F"FY^_Rjhjjjh@h"Fn ;FZoF 6DB :DB7:D;6DvUjh2D56Dh0H5;F 2D8FEFaEEEFEFFaEkFoFjhoF5kF59 E =Eu =EvzEE8Ft5F>\t>/uVj5?F5?FJ?F?FaRVW.u%Razd=Z7F?FBB FE FKFB FRh7FjhhE5EZ7F?FRQ5 Fh2 EhB F YZB FKFRh7FjhhE5EZ7F?FBRQPh2 EhB F YZB FKFRh7FjhhE5ECZ7F?F B7tRQPh2 EhB F\ YZB FEKFRh7FjhhE5EZ7F?F B;tRQPh2 EhB F YZB FEKFRh7FjhhE5E|Z7F F5 F;F?FWSFWVQr0u FWVQ FDF Y^_a FBFKFRh7FjhhE5EZVWQr FY_^?F FKFRh7FjhhE5EZVWQr$ FY_^?F FKFRh7FjhhE5EEZ?FB F F FKFRh7FjhhE5EZ?Fz6tLF%=ERuz5tUF\FNFKFRh7FjhhE5EZGF:1t CF CF Rh7F5;Fh+hE5E]Z7F?FRQ5 Fh2 EhB Fy YZB FKFRh7FjhhE5EZ7F?FB RQPh2 EhB F" YZB FKFRh7FjhhE5EZ7F?FB|‹EB`EEB FZfaB FKFRh7FjhhE5ENZ7F?F B}‹EB7t`EEB FeaB FEKFRh7FjhhE5EZ7F?F B;tRQPh2 EhB F YZB FEKFRh7FjhhE5EZ` F=rbFЋB7 F=Et-jjh hE5E6 F F FbFЋB7;Ft$B F;Bub u z t F F;  Fua`F KF GF OF F F F'=9 F0u  FrF9 FF F{F F F wE0+ Fh FjhhD5E KFGFOF ! F% F! Fȋ nFbFfFЋB uGF=! FuaÃ=GF 5fF F F F'5fF0 wF FrF F F nF FRh FjhhD5E3ZKEEGF F F F' FE F F nF FRh FjhhD5EZKEEGFbGF F Ffz<.u  FSFƒ=jF F FRh FjhhD5EJZB GFWPF FB7BGFX_` F=rbFЊB4 FB F=Et-jjh hE5E F F FbFЊB48 Ffz<.B F;Bz5 uxz<$MFTtzz<$Usnunz<$Logtez<$Volt\z<$AtttSz<$BittJz<$BootAz<$Badt8z<$Sect/z<$Extt&z<$UpCtzt&E8FuE ;FuEEEuuS^Z_YUQWRVEbF  F=jFNt=z6u}t'E ;B7ufFEE ;BufF€fz5u!}tPE8B4uHE ;B u@E5E8B4u-E ;Bu%z{uzwzr z;ufF€^Z_YUQWRVE}u$3ҊNPS Nw[EXGH u؋E^Z_YU Fjjh hE5EEEE+ FEE EPjhhE5EuB F/hAjh05EcF FUWjjh5EEEE u܏EEPjh5EQEOw_UWDžDž} uaDžPuh-5EPHPu h-5EP +} u_DžPuh-5EPPu h-5EbP+}uiDžPuh-5E%PP,Pu h-5EPP!}uiDžPuh-5EPPPu h-5EPP}uiDžPuh-5EGPPNPu h-5EPPC}uiDžPuh-5EPPPu h-5EPP}uiDžPuh-5EiPPpPu h-5E<PP=e} uiDžPuh-5EPPPu h-5EPP})uiDžPuh-5EPPPu h-5E^PP_}*uiDžPuh-5EPP#Pu h-5EPP}3uaDžPuh-5EPPu h-5EP+}4u_DžPuh-5EFPPu h-5EPu+L}=uiDžPuh-5EPPPu h-5EPP}>uiDžPuh-5ErPPyPu h-5EEPPFn}GuiDžPuh-5EPP Pu h-5EPP}HuiDžPuh-5EPPPu h-5EgPPh}QuaDžPuh-5E%P|Pu h-5EPT+)}Ru_DžPuh-5EPPu h-5EP+}[u^Dž Puh-5EYPPu h-5E1P+`}\uZDž Puh-5EPLPu h-5EP$+_ =EREEgFEhEjhhE5Em EEEFEPhEjhhE5E,EEFEdhEjhhE5EEEFEdhEjhhE5EEEFE(hEjhhE5E~EEFE4hEjhhE5EDEEFEhEjhhE5E EEFEVhEjhhE5EEEFE`hEjhhE5EEEFE`hEj hhE5E\EEFE2hEj hhE5E"EEFEhEjhhE5E EEEFEFhEjhhE5EEEFEdhEjhhE5EhEEFEdhEjhhE5E.EEFE(hEjhhE5EEEFE4hEjhhE5EEE#FEhEjhhE5EEE%FEVhEjhhE5EFEE3FE`hEjhhE5E EECFE`hEj hhE5EEEQFE2hEj hhE5EÀ=EREEXFEhEjhhE5EP EEEuFEPhEjhhE5EEE|FEdhEjhhE5EEEFEdhEjhhE5EEEFEZhEjhhE5EaEEFE*hEjhhE5E'EEFE*hEjhhE5EEEFEhEjhhE5EEEFEPhEjhhE5EyEEFE`hEj hhE5E?EEFEFhEj hhE5EEEFEhEjhhE5E EEEFEFhEjhhE5EEEFEdhEjhhE5EKEEFEdhEjhhE5EEEFE(hEjhhE5EEEFE4hEjhhE5EEE#FEhEjhhE5EcEE%FEVhEjhhE5E)EE3FE`hEjhhE5EEECFERhEj hhE5EEEQFEFhEj hhE5E{U} =ERuhFhjughBFh@uPhsFh_u>hFh`u,hFhauhFhbuhFhcuhFhduhFheuҿhFhfuhFhju访=ERu*WVQEEY^_hFjj uk(WVQEEY^_h>Fjj uAjhhuKEhBu蝾y E3Pjh 5y EfEjjf5Eh5y EԾ}E\} u5Ej%?} uLEf %=@u/=Eu 5E軾5E谾=Eujо} =Fu5Eu۽ug=ERu*WVQEEY^_hFjj u(WVQEEY^_h>Fjj uǽF@%&E5FfEjjf5Eh5y E臽0E+EȡF% EEF+F5E5iEE5ERPh| EhEL X5*ERPh| Eh E, XPh| EhE =E0uE = E0u f E  E:= E0u E = E0u f E  E:`j5EhCusj5 EhDu^j5EhEuIj5EhFu4j5GEhGuj5KEhHu EE5EjPhIuEE5EjPhJuȻE#E5EjPhKu觻'E+E5EjPhLu膻a U} =ERhBFhI&uCh\FhJ&u1hhFhK&uhxFhL&u hFhM&uhFhO&uhFhN&u׺hFhH&uź3FhFhI&u詺hFhJ&u藺hFhK&u腺hFhL&ushFhM&uahFhO&uOhFhN&u=h#FhH&u+FPjj ujhhuEhQ&ucy EfE3Pjh 5y E赹jjf5Eh5y E蚹CE} u5E¹j} uLEf =H&u/=Eu 5E聹5Ev=Euj薹} =Fu5Eu衸u-U葹E+E<5&Eȡ8FtY%oFEE EF%oFEEEEGEGE@E aWVQFEY^_WVQFaF#Y^_WVQ>FF#Y^_WVQFF#Y^_WVQ>FF#Y^_5EίEEEFFFwG=ERujhFhFj F}jh\FhsFjF^WVQFF#Y^_WVQ>FF#Y^_1EFjh!h5F蓮a^_ZYQRWVF #F FF^FbFz<$I4Duz5 zBu;SEs @_E ޡSE+_EFcEBF+SEFcE/EF;SEs @_ESE+_EcE^5SESEVCSESEgE.a^_ZYQRWVf@zFfDEBzFFEyFKEzFEyFOEyFSEzFWEUkzFgEFkWEwE =yFu xExE =yFu yE yEӡ~FtFFzEzF~EWVQEDzF>Y^_jhEhhCE5E聦^_ZYQRWV=Eu>jhjjjh@hrE虥EjhFE5FhsF5E1=yFt=Ek=yFu]=*DUu 1G5G SEr FPhB EhE $E|f@zFf%EBzF'E`yFzF F`PhFhBFˤ a`RhFhFF趤 aDF >0u FWVQ)EDF Y^_a4E|zF5EhiEE|zFFERiVE|XE|yFPh6 EhYE6 bE|5yFh6 EhcE lE|=yFu=ERu mEmEFmE =yFu oE =ERu oEoED=zFtN~FFFPhB EhqE苣 |E|5zFh& Eh}El E|(}E !WVQqEE Y^_|E|E|WVQEDzF>Y^_E>tAF jjhEPhE5E谣^_ZYQRWV=yFt&=zFu=yF=yFf=DzF$I=DzF$MFTuf=HzF=yFu=E =E{=E@zFEE =EDOC u=E=?=ERTF u=E!=EXLS u=E=EMDB u=E=EPPT u=E=EARJ u=E=ERAR u=E=EZIP u=Ekm=EDBX u=EMO=EPST u=E/1=EPSD u=E=EAI u=E=ECDR u=E=EDWG u=E=EPLA u=E=EPDF u=E{}=EPGD u=E]_=EZIP u=E?A=EGIF u=E!#=ETIF u= E=EJPG u= E=EAVI u= E=EMP3 u= E=EWAW u= E=ENEF u=Emo=ECR2 u=EOQf@zFf9EuBzF8Eu=E!#f@zFf9EuBzF8Eu=Ef@zFf9EuBzF8Eu=Ef@zFf9EuBzF8Eu=E=Etq=EtDzFE"8u AB<u_=EtDzFE"8u AB<u:=EtDzFE"8u AB<u=Eu t^_ZYøF @zF8t;tÍIF F8t;tQRWVyFzF5EEyFjPjjjjeEjjjj5E˝EEjjjjjhh$ E$nFI|FEV5E>u^E%EW=EEEWO%aEEEFE%EEE%aEkFoFE%aEoF_^jhoF5kF5nF =Eu=E EE Ejh] E5E5E5nF跜EE)EEu=EuEE5nFڛnF^_ZYItGÍIQRWV1EMEE; Ev E;Fv+FDEDA}^_ZYU} =ERuhFu()hFuhFh uhѿFh uh߿Fh uΚhFh u輚hFh u誚hFh u蘚h,Fh u膚h=Fh uthRFh ubhFh uPhFh u>hFh u,hFh uhFh uhFh uhFh uh Fh uҙh'Fh uhDFh u讙haFh u蜙h~Fh u芙hFh uxhFh ufhFh uThFhuBh*Fh u0h|Fh uhFh u hFh uhFh ujEffPh uޗjEffPh uėjEffPh u誗jEffPh u萗jEffPh uvjEffPh u\jEffPh uBjEffPh u(jEffPh ujEffPh ujEffPh uږjEffPh ujEffPh u視jEffPh u茖jEffPh urjEffPh uXjEffPh u>jEffPh u$j EffPh u j EffPh uj EffPh u֕j EffPh u輕j EffPh u袕jEffPh u舕hEh ufjEffPh u\hEh u:jEffPh u0hEh ujEffPh uhEh ujEffPh uؔj EffPh u辔j EffPh u褔j EffPh u芔j EffPh upj EffPh uVjEffPh u<jEffPh u"jEffPh ujEffPh ujEffPh uԓhEh u貔jEffPh u訓hEh u膔jEffPh u|hEh uZjEffPh uPjEffPh u6jEffPh ujEffPh uh uUjP/h u@jPh u+jPh ujPh ujPےh ujPƒh uגjP豒0} uEju蘒} Ef f= jhFh uzt7jhFh uat%Ft%Fb=FNtT=ERuj0hFhFjdj0hFhFjOjh u肒jh us9F0Eh uőjjhP4Eh u褑jjhPEh u胑jjhPEh ubjjhPёEh uAjjhP谑Eh u jjhP菑Eh ujjhPnEh uސjjhPMEh u轐jjhP,Eh u蜐jjhP Eh u{jjhPEh uZjjhPɐEh u9jjhP訐Eh ujjhP臐Eh ujjhPfEh u֏jjhPEEh u赏jjhP$Eh u蔏jjhPEh usjjhPEh uRjjhPEh u1jjhP蠏EjhEh uEK+h ujjhPaEjhEh u֎E +h u賎jjhP"EjhEh u藎E*h utjjhPEjhEh uXE*h u5jjhP褎Eh ujjhP胎 Eh ujjhPb Eh uҍjjhPA Eh u豍jjhP  Eh u萍jjhP Eh uojjhPލEh uNjjhP轍Eh u-jjhP蜍Eh u jjhP{Eh ujjhPZEEju諌= u9h u誌jjhP jh u# = u9hujjjhPٌ jh u = u9h u*jjhP虌m jh u裋Y = u9h ujjhPY- jh uc = u9h u誋jjhP jh u# = u9h ujjjhPً jh u = u9h u*jjhP虋m jh u裊Y = u9h ujjhPY- jh uc = u9h u誊jjhP jh u# = u9h ujjjhPي jh u = u9h u*jjhP虊m jh u裉Y = u9h ujjhPY- jh uc = u9h u誉jjhP jh u# = u9h ujjjhPى jh u = u9h u*jjhP虉m jh u裈Y = u9h ujjhPY- jh uc = u9h u誈jjhP jh u# = u9h ujjjhPو jh u = u9h u*jjhP虈m jh u裇Y = u9h ujjhPY- jh uc = u9h u誇jjhPjh u#= u9h ujjjhPهjh u= u9h u*jjhP虇mjh u裆Y= u9h ujjhPY-jhuc= u9h u誆jjhPjh u#= hufjjhPՆujjhP譅uah$u`jP{` E0mG=E.uh$uw`jPQ`h_ Ehb$u` E11G=E.uh$u;`jP`h_ Ehc$u` E2F=E.uh$u_jP_h_ Ehd$uu` E3F=E.uh$u_jP_h_ Ehe$u9` E4}F=E.uh$u_jPa_h_ Ehf$u_ E5AF=E.uh$uK_jP%_h_ Ehg$u_ E6F=E.uh$u_jP^h_ Ehh$u_ E7E=E.uh$u^jP^h_ Ehi$uI_hX$u^jP^hY$u^jPq^h[$u^jP\^h\$um^jPG^h^$uX^jP2^h_$uC^jP^hl$u.^jP^h$u^jP]hp$u^jP]h$u]jP]"E@E?b} uj^ju]F} 0Ef (=$KgDh$5Du]jjhP]<t=jjhs$5DT]jjhr$5D>]kD+؉oDgDh$5D]jjhP]<t=jjhu$5D\jjht$5D\sD+؉wDgDh$5D\jjhP$]<t=jjhw$5D\jjhv$5D~\{D+؉DgDh$5DU\jjhP\<t=jjhy$5D4\jjhx$5D\D+؉DgDh$5D[jjhPd\<t=jjh{$5D[jjhz$5D[D+؉DgDh$5D[jjhP\<t=jjh}$5Dt[Djjh|$5DY[+؉DgDh$5D5[jjhP[<t=jjh$5D[Djjh~$5DZ+؉DgDh$5DZjjhPD[<t=jjh$5DZDjjh$5DZ+؉DgDjjhp$5DwZFjjhl$5D^ZFju1Z=$uE0 E0"E1=$uE1 E1"E2{=$uE2 E2"E3U=$uE3 E3"E4/=$uE4 E4"E5k =$uE5 E5"E6H=$uE6 E6"E7%=$QE7 E7"E8?5 EE5 EE5 EE5 EE5 EE5 EEhX$uXjPXhY$uXjPXh[$uXjPyXh\$uXjPdXh^$uuXjPOXh_$u`XjP:Xhl$uKXjP%Xhp$u6XjPXh$u!XjPWh$u XjPWh$5DWjPWj=$h$5DWjjhP;X<tYjjhr$uW;KDr;; Ew3jjhr$uW;r; Ewjh$u WsDjhr$uWjhs$uWjh$uV=$h$5DVjjhPnW<tYjjht$uV;KDr;; Ew3jjht$uV;r; Ewjh$u=VsDjht$uWjhu$uVjh$uU=$h$5D2VjjhPV<tYjjhv$uV;KDr;; Ew3jjhv$uU;r; Ewjh$upUNR{Djhv$u8Vjhw$u)Vjh$u*U=$h$5DeUjjhPU<tYjjhx$uGU;KDr;; Ew3jjhx$u$U;r; Ewjh$uTDjhx$ukUjhy$u\Ujh$u]T;6=$h$5DTjjhPU<tYjjhz$uzT;KDr;; Ew3jjhz$uWT;r; Ewjh$uSDjhz$uTjh{$uTjh$uSni=$h$5DSjjhP:T<tYjjh|$uS;KDr;; Ew3jjh|$uS;r; Ewjh$u S Djh|$uSjh}$uSjh$uR =$h$5DRjjhPmS<tYjjh~$uR;KDr;; Ew3jjh~$uR;r; Ewjh$uKyFyF)?D %SD ?D+ȉ KDj5KDhl$uJ?D+ =fDu&z=ZEuQ= Hz=ERuj0hDhDjnJSj0hDhDjVJ;=ERuj0hDhDj5Jj0hDhDj Jjhr$5DPJjhs$5D>Jjht$5D,Jjhu$5DJjhv$5DJjhw$5DIjhx$5DIjhy$5DIjhz$5DIjh{$5DIjh|$5DIjh}$5DIjh~$5DxIjh$5DfIjh$5DTIjh$5DBIjh$5D@Hjh$5D.Hjh$5DHjh$5D Hjh$5DGjh$5DGjh$5DGjh$5DGh$5DHjPGh$5DGjPGh$5DGjPGh$5DGjPGh$5DGjPGh$5DGjPtGh$5DGjP\Gh$5DjGjPDGhr$5DRGjP,Ghs$5D:GjPGht$5D"GjPFhu$5D GjPFhv$5DFjPFhw$5DFjPFhx$5DFjPFhy$5DFjPFhz$5DFjPlFh{$5DzFjPTFh|$5DbFjPEeE,Y^_WVQEE,Y^_WVQ>EE(Y^_ FgEFbEEEWVQEEY^_WVQEE(Y^_WVQEEY^_iEɿEWVQ˿EEY^_JE)FtENWVQEELY^_WVQEELY^_WVQEMELY^_WVQEEOY^_WVQhEEOY^_WVQEEOY^_E)FEMWVQEELY^_WVQEELY^_WVQEMELY^_WVQEEOY^_WVQEEOY^_WVQ[EEOY^_E)FhEXMWVQ EELY^_WVQEELY^_WVQEMELY^_WVQEEOY^_WVQ6EEOY^_WVQE EOY^_E)FELWVQEELY^_WVQEELY^_WVQEMELY^_WVQ'EEOY^_WVQuEEOY^_WVQٺEEOY^_E)F\ELWVQEELY^_WVQ|EELY^_WVQEMELY^_WVQfE|EOY^_WVQEEOY^_WVQEEOY^_E)FֲEoKWVQxEELY^_WVQEELY^_WVQtEMELY^_WVQEEOY^_WVQEtEOY^_WVQWExEOY^_E)FPEJWVQEELY^_WVQpEELY^_WVQEMELY^_WVQEpEOY^_WVQ2EEOY^_WVQEEOY^_E)FʵE)JWVQlEELY^_WVQEELY^_WVQhEMELY^_WVQ#EEOY^_WVQqEhEOY^_WVQտElEOY^_a`E$nPERZ? t? t5)Fu1O5)E$>PERZFAGAtE=EuEECEO5)Ef~NTuV E NTfEFSF0>EF8BEF(V,.E2E6E:E f~6FAu> EFAT-fE16F2EF:E>EBEf~RFAuC>EBE EFAT-fE32F$2E:EF,6Ej E????fE??E????E????*E.E2E6E:E>EBEfFuF "E&E5mE%aE5iEPhL EhE2 fEf EE,F *EF.Ea`]E F F  EEfE 5} EE5 EEWVQEh EY^_WVQEE(Y^_=E.uWVQEE(Y^_jjjjjhh EH1= Ejh] EhhO5 E1==Ooft =OFomSt=OFomsuoFBAK FOFF > EEjhE5E5 E=1jh] EhhO5 E1=O=Uf=ONTtf=OFAtf=֜OFA E00RZME]EMEME0P5MEF E0 RZQEQEO]ERZQE`O=QEaDbO=bO#=bOt?=bOt6=bOt-=bOt$=bO't=bO t=bO t =bOu FMBR fOrO=rOt?=rOt6=rOt-=rOt$=rO't=rO t=rO t =rOu FMBR vOO=Ot?=Ot6=Ot-=Ot$=O't=O t=O t =Ou FMBR OO=Ot?=Ot6=Ot-=Ot$=O't=O t=O t =Ou FMBR ObO=bOt =bOufOeE?rO=rOt =rOuvOeE?=Ot =OuOeE?=Ot =OuOeEd? FGPT N5 E\- Ea`EE E$0RZAEEE]EEE0PEEEEB` 2P=EEEEGa E$ RZIE]ERZIEOIEE+kFoFE%aEoFjhD5D5 E-zjh] EhhlO5 E,lOUt0PEE=IE󤾠lO~NTFSuwF8P=AEF0 5P=EEF4GF86P=EEFBGF 9P=AE3P=EEF(^,_ 2P=EE_~RFAT3u{FR8P=AEF 9P=AEF`:P=AEfF H3P=EEG 2P=EEF$ ;P=AEF,;P=AE~6FAT1F68P=AEF 9P=AEF`:P=AEfFF H3P=EEG ;P=AEf;P=AEF PE󤡕E=Pa=jjjjjhh E(=E EERZ$>P}jh] EhP5E E(ERZ$nP 5E E (E Ejjjjjhh E'=E E E E E E E E E E E Ejh Ehh Eh h Eh5E E'` EERZ$nP f<u u fFGFGaERZ$>PP jh] EhhlO5E E}'_lO5E E&tERZ$nP ERZ$>PPjh] EhhlO5E E'_lO5E E_&E EE=E,aU쐐} `=ERu3h\Gu%hxGhu%hGhu%1hGu%hGhu%hGhu%hZEhuu%EjPhuZ%=ZE?u*hu$jP$hu$jP$a/} udEjud$} Ef=`jhVEhuE$VEtY%EEE EF%EEEEEGEGE@EajuZ! `fDjDjjjjjhh$ E"9 E>"G/h "jh3QD5FhJE5 E 59 E!jjjjjhh$ E!9 E!GWVQGG Y^_DPhB EhGG! G|D?BPPhm EhG! G XRPhT EhG   G-XPhf EhG  G-5GhGh'G  ,G DEEDE5EE5E#EzjhE5E59 E jh] EhhlO59 E t) fD5fDhGhװD  ܰD 59 Ejjjjjhh$ E9 E0 h jh3QD5FhJE5 EWVQGG Y^_D@PhB EhGy G|D?BPPhm EhGJ G XRPhT EhG"  G-XPhf EhG G-5GhGh'G ,G D@EEDE5EE5E#EjhE5E59 E2jh] EhhnO59 E t jD59 ET9 E;+aÍIDD EBxE EtEpE5pEht Eh_E `E_EbE fE 5tEht EhxE E 5xEht EhE E DE5 EIETE`2JBGG%aEkFoFG%aEoFjhoF5kF59 EGG+1G5G@VEZE;ErEEE%aEjEjh] E5jEh2J59 EA2JwG= GWVQGXG Y^_1G5GPhB EhGH G|5G1G?BPPhm EhG G XRPhT EhG  G-XPhf EhG G-5GhGh'G ,G "D7hS59 Ejjjjjhh$ E9 E6GWVQGG Y^_5G1GPhB EhG% G|5G1G?BPPhm EhG G XRPhT EhG  G-XPhf EhG G-5GhGh'G ,G "D7^jh3QD5FhJE5 Ea59 EXjjjjjhh$ EK9 EWE42J] E=] Eu H*5aE=unEEHaHáErE2JvE1GzE5GzEzE%aEDD~E%aEDjhoF5kF59 EVWQE=vEY_^jh] Eh5vE59 EWVQGeG Y^_aGGzEPhB EhUG `G WVQGUG Y^_WVQGUG Y^_~EzE?BPPhm EhG G)WVQGGY^_WVQGGY^_XRPhT EhmG3 sG WVQGmGY^_WVQGmGY^_XPhf Eh~G G WVQG~GY^_WVQG~GY^_5GhGhG G WVQ&GGY^_WVQ'GGY^_"D7:=GuL=ERuj3hGhGjj3hGhGjujFt Gh59 Ejjjjjhh$ E9 E#/GWVQGG Y^_1GPhB EhG G|1G?BPPhm EhG` G XRPhT EhG8  G-XPhf EhG G-5GhGh'G ,G "D7jh(LD5FhFE5 E59 Ejjjjjhh$ E9 EzE~EvE rEE%aE] E`nEG-GGG+GGxG|GVEZEGG_GhEjhjjjhh G$GjhEhh}G5$G(G5 Ejjjjjhh$ E9 Ejh] EhhO59 EjhEhhO5$G _G5G -GG=Gu =Gd=_Gt=cG&뺃=gGt,=cGt#1G+G5GG= Nw눐91G+G5GGG;uG;uGr GOGWVQGGY^_WVQGGY^_jhEjhG5$GG=G u=GuGG_G=cGu1GG5GG_G1GG5GG_GsfG=GuR=ERujhGhGjjhGh Gj5$Gmh GjG)GPht EhIG7 GPhL EhyG G yGpG}GtGG-G5EGjjj5$G}jhEhh}G5$G5$GWVQeGGY^_(GuGjjjjjhhdGyGjhh5FaU} GGEExG|GEEjhhuEhQu+y E3Pjh 5y EfEjjf5Eh5y Eb E=ER%WVQEEY^_hGhRu4h˚GhYu"hךGh[uhߚGh]uhGh_uhGhauhGhcuh(Ghhuh;GhSuhDGhUuhMGhWuhUGhdunhcGhfu\hqGhjuJh?GuO h|GhRu&hGhYuhGh[uhGh]uhGh_uhGhauhƛGhcuhGhhuhGhSuhGhUuh GhWurhGhdu`h"GhfuNh0Ghju<h`GuAhEhTuhEhVu hEhXu hEhZu hEh\u hEh^u hEh`u hEhbu hEhiu } u j } Ef =jum=ERuj4h6GhVGj j4hKGheGj t-jz 5$G? PGh GO jT dEJ} 4=fGu*5EuT u jj5F1 =fGu5PG PGj 1GFZ^hFhZuX ^EF9^hFh\u7 1G5G?B\GXGTGj5TGhTu j5XGhVu j5\GhXu _ E+Eȡ1G+G5GG^EbEE%EPhx EhE  hEh`uK xG|G+^EbEhG5E5iEE5ERPh| EhE(  X5*ERPh| Eh E  XPh| EhE  =E0uE = E0u f E  E:$= E0u E = E0u f E  E:GhGhguP hkGheu> j5Ghiu# hEhPu ^EbE%&E5xGfEjjf5Eh5y E j5\GhXu j5hGh^u j5Ghbu  `=5Gu0GGGG1G5G$GG=GuGG̡GGGG1G5G2JGhtGh u,hGh uhGuhGh uhGh uhGh uhGh uhGh uhGh uh#Gh uh.Gh uxh.Gh ufhE4jjjjjhh G$GGGhGh uhkGh u} u uu} =PGtEPuE=Guhh3jj5Gu*hh3jj5Gu EPu5GGj5Gh uR} E= u#G G; G G= u" G=GG= uG= u G G|= u/jh6Gh u&h6G4s;GF= jh, h5F=u G;v GG`h ujPh ujPph ujP[h uljPFh uWjP1=Gt 5GGHGGjhG5G5$Gqjh] EjhG5$GLWVQGGY^_WVQGGY^_=$GGGGGGjhG5G5yGG`G'E=G󥾴EJuaGGjh] E5GP5yGqt`5GhFhN%u,hFhd%uhFhb%uhFhX%uhFh%uhFh%uhFh,%uhFh0%uh%Fh3%uh;Fh6%uhOFh8%uxhdFh:%ufhFh%uThFh%uBuhFuBhFh<%uhFh=%u h`Fh%uhkFh%uhxFh(%uh@Fh&%uhWFhN%uhFhd%uhFhb%uhFhX%u|hFh%ujhFh%uXhFh,%uFhFh0%u4hFh3%u"hFh6%uhFh8%uhFh:%uhFh%uh"Fh%u~ELEE E0=E0uW5 EE5 EE5 EE5 EE5 EE5 EEjh$u]h_ Ehb$u;=E.uh$ujPo E1a=E1uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehc$u=E.uh$ujP E2=E2uW5 EE5 EE5 EE5 EE5 EE5 EEjh$u%h_ Ehd$u=E.uh$u]jP7 E3)=E3uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehe$ug=E.uh$ujP E4=E4uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehf$u=E.uh$u%jP E5=E5uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uQh_ Ehg$u/=E.uh$ujPc E6U=E6uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehh$u=E.uh$ujP E7=E7uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehi$u=E.uh$uQjP+=~ECu%=~ELu=~E ujhF%u=EMujh)%u)=E2ujh*%ujh+%uu=E?.hEh'%5EChEhO%5E.hEh-%5EhEh;%5EhEh.%5EhEh4%5EhEh1%5EhEh7%5EhEh/%5EhEh2%5EhEh5%5EqhEh9%5E\jh)%u]jh*%uNjh+%u?:j5Eh'%5E j5EhO%5Ej5Eh-%5Ej5Eh;%5Ej5Eh.%5Ej5Eh4%5Ej5Eh1%5E|j5Eh7%5Edj5Eh/%5ELj5Eh2%5E4j5Eh5%5Ej5Eh9%5Eh'%umjPG'} uju3} Ef =%jjh;%u Ejjh-%uEE5 EiFkFVirtjjjjjhh$ E9 EE%EE%aEEEE%aEEjhE5E59 E4jh] EhhlO59 E59 E9 EG`zF zF5E E`E,aI|FEE>tn%EEE EF%EEEEEEEGEGEW E@Ejhh5Fju==b%u&jh?h5Fju=d%u&jh@h5Feju=X%u&jh>h5F8ju=%u~EL r=$uE0 E0"E1L=$uE1 E1"E2&=$uE2 E2"E3=$uE3 E3"E4=$uE4 E4"E5e=$uE5 E5"E6B=$uE6 E6"E7t=$um`E7 E7"E8q5 EE5 EE5 EE5 EE5 EE5 EE `jh5BEjh55BEjh65BEjh75BEjh;5BEjh85BEjh95BEjh<5BEvm!FVWVQFF#Y^_WVQ>FF#Y^_5EEEEFFFwG=ERujhFhFjWFsjh\FhsFj8FTWVQFF#Y^_WVQ>FF#Y^_~AFjh!h5Fa`EyFjjjjjhhyF6yF EEj5yFjjjjEjjjj5E~EE3t==ERujhDhrDjFjjhDhȳDj,jEEV5E~u^F+@%aEEEWF%aEkFoF_^jhoF5kF5yF=Eu=E EE Ejh] E5E5E5yFEEE)EEu=EuE E 5yFyFa`EyFjjjjjhhyFyF EEEEjhhjEEV5E~u^EF+@E%aEEEWFE%aEkFoFF E%aEoF_^jhoF5kF5yFY=Eu.=E"EEuEEAEjh] E5E5E5yFEKE)EE냃=EvEE5yF yFa`E5EEa`VWQlOY_^ XF=ZE=yFtC=yFtfEKfEAGEfEKfEDKE=DzF$MFTf=HzFWVQzFWEY^_to=yFufOEWVQWEzFY^_WEWEwEEzF I|FكuEE=yFt<=DzF$MFTt^fEFfEAEyFEzF#E.fEFfED EyF'EzF+Ef=DzF$Iu=Ep9Hue=yFt*=DzF$MFTt:EyFEzFEEyFEzFE5SESE<SEaRjhjjjhhEEkFoFjhoF5kF5E P FXF5Fj@bFkFoFjhoF5kF5Ejh] E5F5bF5E5EEhEZU} =ERhJFuhFh%u\hFh<%uJhFh=%u8hFh%u&hFh%uhFh&%uhFhN%uhFhb%uhFhX%uhFh%uhFh%u-hFuhFh%uhFh<%urhFh=%u`h`Fh%uNhkFh%u<h@Fh&%u*h@FhN%uhFhb%uhFhX%uhFh%uhOFh%uhFh%uh8Fh%uheFh%uhFh%uhFh%uv~ElEE E0=E0uW5 EE5 EE5 EE5 EE5 EE5 EEjh$u h_ Ehb$u=E.uh$uCjP E1=E1uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uoh_ Ehc$uM=E.uh$ujP E2s=E2uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehd$u=E.uh$u jP E3=E3uW5 EE5 EE5 EE5 EE5 EE5 EEjh$u7h_ Ehe$u=E.uh$uojPI E4;=E4uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehf$uy=E.uh$ujP E5=E5uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehg$u=E.uh$u7jP E6=E6uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uch_ Ehh$uA=E.uh$ujPu E7g=E7uW5 EE5 EE5 EE5 EE5 EE5 EEjh$uh_ Ehi$u=E.uh$ujP=~E ujhF%ujhG%un=E?hEhO%5E<hEh'%5E'hEh-%5EhEh;%5EjhF%ujhG%uhF%uBjPhG%u-jPEND35>Fh'%5EENDl35>FhO%5Efj5Eh-%5EHj5Eh;%5E0hF%ujPshG%ujP^hO%uojPI} uju5} Ef =%jjh;%uEjjh-%uEE5 Ejjjjjhh$ E9 EE%EE%aEEEE%aEEjhE5E59 EJjh] EhhlO59 E59 E9 E]KzF zF5E E`E,aI|FEE>tc%EEE EF%EEEEEGW EEGE@Ejhh5Fju^=b%u&jh?h5Fju1=X%u&jh>h5Fju=F%u~Ec=G%u~El=$ul`E0 E05 EE5 EE5 EE5 EE5 EE5 EED(a=$ul`E1 E195 EE5 EE5 EE5 EE5 EE5 EEѴ赺a=$ul`E2 E25 EE5 EE5 EE5 EE5 EE5 EE^Ba7=$ul`E3 E3S5 EE5 EE5 EE5 EE5 EE5 EEϹa=$ul`E4 E45 EE5 EE5 EE5 EE5 EE5 EEx\aQ=$ul`E5 E5m5 EE5 EE5 EE5 EE5 EE5 EEa=$ui`E6 E65 EE5 EE5 EE5 EE5 EE5 EE蒲van=$ug`E7 E75 EE5 EE5 EE5 EE5 EE5 EE"a Ij hEhO%5E3Ec;Erw;EvEEEE趷hyFhO%5EeE5 Ejjjjjhh$ E9 EE%aEkFoFE%aEoFjhoF5kF59 E=jh] EhhlO59 ElO59 E9 EKE=ZE=DzF$MFT=HzF=ERu,hׯFhP%5EvhFhQ%5Ea*hFhP%5EJhFhQ%5E5I|F>tzF5aEEI|FFE%EE‹E5EE5EE)EEEND*hNDh'%5Ej5Eh-%5Ezj5Eh;%5EbhX%5EjPhb%5EjPf=ND? h%5EjPchFhP%5EhFhQ%5EhX%5EBjPhb%5E*jPh%5EjPhEh'%5EhEh-%5EphEh;%5E[U} =ERhFuBhFh<%uhFh&%u hFhN%uhFhZ%uhFh%uhFhS%uhuFh%uhFh%uch~FuhFh%u|h@Fh&%ujh@FhN%uXh@FhZ%uFhOFh%u4h1Fh%u"hFh%uhtFh%uhFh<%uhFh=%uh`Fh%uhkFh%uhFhd%uhFhb%uhFhX%uhFh%unhFhS%u\hFh%uJhFh%u8EE E0t=E0u'5 EE5 EEjh$uh_ Ehb$u=E.uh$u<jP E1=E1u'5 EE5 EEjh$uh_ Ehc$uv=E.uh$ujP E2蜺=E2u'5 EE5 EEjh$u,h_ Ehd$u =E.uh$udjP> E30=E3u'5 EE5 EEjh$uh_ Ehe$u=E.uh$ujP E4Ĺ=E4u'5 EE5 EEjh$uTh_ Ehf$u2=E.uh$ujPf E5X=E5u'5 EE5 EEjh$uh_ Ehg$u=E.uh$u jP E6=E6u'5 EE5 EEjh$u|h_ Ehh$uZ=E.uh$ujP E7耸=E7u'5 EE5 EEjh$uh_ Ehi$u=E.uh$uHjP"=E?=iFCujhR%ujhS%uhR%ujPhS%ujPh[%5EjPhU%5EjPhW%5EjPzhY%ujPejP] jFjF7hyFh[%5Ej5Eh;%5E/hEh'%5EhEhO%5EhEh-%5EhEh;%5EphEhO%5E[hEh]%5EFhEh^%5E1hEh_%5EhEh`%5EhEha%5EhEhc%5EhR%u@jPhS%u+jPjhR%ujhS%um} ujuX} BEf :=%E5 Ejjjjjhh$ Eq9 EE%EE%aEEEE%aEEjhE5E59 Ejh] EhhlO59 E59 E9 E,:zF zF5E E`E,aI|FEE>tn%EEE EF%EEEEEEEGEGEW E@Ejhh5Fju"=b%u&jh?h5Fwjuj=X%u&jh>h5FJju==R%uiFC>%=S%uiFL& =$u<`E0 E0p5 EE5 EEa=$u<`E1 E1-5 EE5 EE}a=$u<`E2 E25 EE5 EE:^aD=$u<`E3 E3觲5 EE5 EEa=$u<`E4 E4d5 EE5 EE贑a=$u9`E5 E5!5 EE5 EEqa~=$u9`E6 E65 EE5 EE1Ua>=$u7`E7 E7衱5 EE5 EEa hEh]%5EhEh^%5EhEh_%5EhEh`%5EhEha%5EhEhc%5Ej hiFh[%5EiF1;Erw;EvEE jFjF jFjFyhyFh[%5E(E5 Ejjjjjhh$ EG9 E jF%EEEjF%EEjhE5E59 Ejh] EhhlO59 Er59 E9 ElO5=ZEtg=ERu/hFh]%5EZhFhQ%5EEhFh]%5E+h FhQ%5Ez=yFug=ERu/h!FhQ%5EhFh^%5E9h+FhQ%5EhFh^%5E =ERuhFh]%5EhӬFh]%5El=yFud=ERu/h-Fh^%5EEhiFhQ%5E0hfFh^%5EhFhQ%5Eh=yFu|=ERu,h(Fh^%5Eh>FhQ%5E*h\Fh^%5EhSFhQ%5Eh%5EjPI|FFtFzF zF5F5aEFEj5Eh-%5EyF5 jFE5jFE)EEFFEFDFFEFD5EhP EhέF ϭF 5EhP EhέF ϭF =ERuhFh^%5E_hڭFh^%5EHE5 Ejjjjjhh$ Eg9 EE%EEEE aEEjhE5E59 Ejh] EhhlO59 ElO59 E9 E,1=ZEt==ERuhFh_%5ExhFh_%5E^=DzF$MFTr=HzFeM|FEj5Eh;%5EE E5EE5EE)EEFFEFBFFEȯFB=ERuhMFh`%5EhFh`%5EENDa5>Fh'%5E[END<5>FhO%5E6hFhQ%5E!hb%5EjP[hX%5EijPCh%5EQjP+5=ERuhFhQ%5Eh FhQ%5E`=bGti1G5GGGGGGyF G GGGGbG1G5GGGG yF+ G GGG;Gu%;GuGGyF GGxG9GrON1G5GGGGGGyF G GGGGbGaUİ} 5=ERhqGu)hRrGhVuhdrGhWuhxrGhXuhrGhYuh+sGhNuh6sGhZuhBsGh[uhOsGh\uh]sGh]uuhsGh^uchsGh_uQhsGh`u?hsGhau-h tGhbuh@tGhcu hDtGheuhJtGhguhOtGhiuhntGhjuhrtGhluhxtGhnuh}tGhpuhtGhsuyhtGhtughtGhuuUh"rGuUhrGhVu1hrGhWuhrGhXu hrGhYuh1sGhNuhjsGhZu׿hssGh[uſh{sGh\u賿hsGh]u衿hsGh^u菿hsGh_u}hsGh`ukhtGhauYh uGhbuGh%uGhcu5h*uGheu#h0uGhguh4uGhiuhJuGhjuhOuGhlu۾hUuGhnuɾhYuGhpu跾hfuGhsu襾huuGhtu蓾huGhuu聾hSuE5ٵFjhuJhEhžhEhTu;hru螽E5ٵFjhuhNuyjPS} u jU} E=N/GjjhOu*r=r/GuGjjhPur=<r</GuGj hƋEhQu˼ƋE;Gw;Gw GGGG/Gj hƋEhRurƋE袌;Gr;Gr;Gw!;Gw,GG/GGG/GGGGNDt5>FhQuqGNDR5>FhRuO=8Gjjhdu觻=s/GvGjjhfu{u/G r /GvGjjhhu;u/Gr/GvGjjhku=r/GvGjjhmuϺu /G v /GvGjjhou菺u/Gv/GvGvG;vGv*/GvGvG vG^;vGwVvG;vGv /GvG vG);vGw!vG;vGv/GvG=/Gtju蚹(j5uGhOuj5uGhPuGND 5>FhQuGND 5>FhRuʹ=8Gt~j5vGhdu覹j5vGhfu葹j5vGhhu|j5vGhkugj5vGhmuRj5vGhou==ERuj0hwGhvGuj0hxGhwGuθ f=S>`WVQE/GY^_hkGַt\uPhE5\uP·EFhQuGND5>FhRuȮhNu+jPhNujPhEhOu臮hEhPuuhEhQuchEhRuQhEhMu>hMu蠭P0 `fFft}F pV F`PhFhBF  a`RhFhFF aBF >0u FDF DF > uF5>Fa`jhhjgPGfGHG IG=GGfGGGGGPhX EhGGa GG.jhjjjhhGGMGGGG'jhFKh 5PG5GGۭfGfG-fGfG GGu GGMfGGGPhX EhGG軬 GG.jhjjjhhGG觬GG=GGrCjhFKh hLG5GG4-GGfG-fGfGu=GGt$jhFKhhLG5GG GGfG=ERuj@hHGhGGjj j@hoIGhHGjejaË`VE$,sP6YFdsP6oFpP6sFwF~usFwFsP6{F$tP6FtP6F=P0iF5 E E{FsFGFGFGF oFG GF%aEjhSj莫GG%aEkFoFjjjjjhh E親 EjhoF5kF5 E%G>D5FBD=BDv8jh] Eh5>D5 Eڪt?>D-BD뼡BD%aEjh] EP5>D5 E蛪uj#aÍIUVEuEP{P{PP^]jh5BE辨jh55BE謨jh65BE蚨jh75BE舨jh;5BEvjh85BEdjh95BERjh<5BE@F5F,F=ERuj4hXCGhCGjyj4hEGhEGjdujjjh5FVÐU($$E$D$D$D$ t$FD$%oFGFt$5jDQD$ t$>F ~ t7>.t2>u-QVWFE_^Yt`FFbDa D$ D$ |$ v=bDu8bDD$ D$D$;oFt0D$%oFGD$Ft$5jDP6D$D$V5G^=sHuD$@D$%oFGD$Ft$5jDoP=bDu|$$]ÐU($$E$D$D$D$ D$%oFGt$5jDFOD$ t$>N ~ t;~ t5F t/>.t*>u"fFf{PfFf{P5{P> D$ D$ |$ vD$ D$D$;oFt0D$%oFGD$Ft$5jDJOID$D$V5G^=s5t0D$%oFGD$Ft$5jDN$$]Ë`5jDjhoF5kF5 E3jh] EhV5 E9aU} B E4E E0eh_ Ehu=E.uhu]jP75 E E5 E$E E1h_ Ehu诤=E.uhu jP5 ELE5 EPE E2轊h_ Ehu[=E.uhu赣jP菣5 ExE5 E|E E3ih_ Ehu=E.uhuajP;5 EE5 EE E4h_ Ehu賣=E.uhu jP5 EE5 EE E5h_ Ehu_=E.uhu蹢jP蓢5 EE5 EE E6mh_ Ehu =E.uhuejP?5 E(E5 E,E E7h_ Ehu跢=E.uhujPh_ Ehu臢PE5 ETE5 EXEj'EffPhu_j(EffPhuEj)EffPhu+j*EffPhuj+EffPhuj,EffPhuݠj-EffPhuàj.EffPhu詠hujP֠hujP=GCu jhugjhuXjhuGjhu8='Eu0=F05EE5 EE5$E E{=(Eu0=F15<EE5LEE5PE EB=)Eu0=F25hEE5xEE5|E E =*Eu0=F35EE5EE5E E=+Eu05E=F4E5EE5E E=,Eu-=F55EE5EE5E Ea=-Eu-=F65EE5(EE5,E E+=F75DEE5TEE5XE EE1 E0=ERh&FhuFhFhu4hFhu"h;FhuhjFhuhFhuhFhuڞhFhuȞWVQ" EC EY^_h" Ehu蟞h\Fhu荞hFu蒞hXFhuihFhuWh%FhuEhEFhu3hFhu!hFhuhFhuh FhuWVQ" EQ EY^_h" EhuheFhu谝h Fu赝h" Ehu葝DD EBxE EtEpEDDzhyFhu=j5Eh54Ej5Eh54Ej5Eh54EhuXjP2='E=(E=)E=*E=+E=,E=-E=.EhuۛjP赛huƛjP蠛hu豛jP苛hu蜛jPvhu臛jPahurjPLhu]jP7huCjPhu.jPhujP=GCuVhujP՚hujPhuњjP諚hu輚jP薚Thu襚jPhu萚jPjhu{jPUhufjP@m} uju1X} BEf :=uI'E(E)E*E+E,E-E.E=F0.=uI'E(E)E*E+E,E-E.E=F1=uI'E(E)E*E+E,E-E.E=F2?=uI'E(E)E*E+E,E-E.E=F3>=uI'E(E)E*E+E,E-E.E=F4=uI'E(E)E*E+E,E-E.E=F5O=uF'E(E)E*E+E,E-E.E=F6Q='E(E)E*E+E,E-E.E=F7=F E~~5 EE5 EE5 E EE1 Eh" EhuhuLjP&hu7jPhu"jP=GLtVhujPޖhujPɖhuږjP贖huŖjP蟖Thu讖jP舖hu虖jPshu脖jP^huojPI`f=uehuIjP#hu4jPhujPhu jPGC`=uehuݕjP跕huȕjP袕hu賕jP荕hu螕jPxGL_=_EpEEtEExEEDED=F ER$E5pEht Eh_Eݕ `E_EbE fE 5tEht EhxE譕 E 5xEht EhE莕 E DE5aEht EhE` E  EIEIE5 E5EEE s=1Eu\1EHEEhEuۓ-E-E)jh]h5E5E5M E[juߓ `FFI|Fa`WEZE @ @ @ @ @ WVQYEEFY^_WVQYEEgY^_WVQ1ZEEgY^_zF~FWVQ3zFE Y^_f@zF BzF WVQDzFEY^_lO<u.WEF<u.WEF<u.WEF<u.WEeF;t % lOfW:yFf:f;t  fD:ff\:ffr  ftft  0t*t G,yFGt yFyFGtyFyFzFyFGf?t 9 GzFGzFG zFG$zFG(zFG,#zFG0'zFG4+zFG8/zFG=r  yFf?0t'f? uyFGtf?0t  GyFDzFOX E|FWZ0_G=r n f?0OXYt0WVQ3zFDzF Y^_DzFOXWZE0_3zFWZ40_;zF>.t N<u;F<t4<@v$ߢ@zFF<t)<@v$ߢAzFF<t<@v$ߢBzF[@zF AzF BzF A E|FDzF5E|F<.tNf@zF BzF IF<><@v$ߢ@zFF*<@v$ߢAzFF<<@v$ߢBzF=E|F rWVQ3zFDzFY^_WVQ3zFDzF Y^_=3zFPu =4zF5u >zF>.tNf@zF BzF F<u @zF <@v$ߢ@zFF<u AzF <@v$ߢAzFF<u BzF <@v$ߢBzF7Gt=r Q?u=yFJ 3?t?ufG fuWVQIXE'REY^_zfuWVQIXE?REY^_[f@uWVQIXEoREY^_FF#Y^_EFjh!h5Fa`=ZEjG=yFNLhGfGFR=yFt-GDG=yFtGDG,G$GFtG=yFtxG|Gf@zFfGBzFGWVQGDzFY^_=yFtJ=yFtAM|FRhB EheG\ pG|5zFh& EhqG= tG|WVQeGE Y^_=zFu yFtt`yFzF F`PhFhBF a`RhFhFF aBF >0u FWVQuGDF Y^_aG|WVQuGE Y^_zFGeDG|zFGODG|yFRh6 EhQG9 ZG|yFRh6 Eh[G dG|=yFtlGG =ERu GGDpGPG>tF@f D&DD`G=G$Attua=GrDefuU=bGtLD5DhGhD`~ |DWVQDEG Y^_tGBrKu PsG=G$Attu =GrDeft6=G$MFTuX=G2uO=G0uF=G1s =G7r4GGr=G$Attt=GrDeft qGa0=bGt!jG=jGrjGaU} X5Gu)}GNDG+GGGZ>G^>Gu=@Brjhhu|jhhu|Eh u|y E3Pjh 5y Ei|fEjjf5Eh5y EE||Ej5Gh u2|=ER&WVQEEY^_h8Gh u|h 9Gh u{h9Gh u{h 9Gh u{h)9Gh u{h99Gh u{h?9Gh u{hM9Gh u{hb9Gh ur{hs9Gh u`{h$:Gh uN{h-:Gh u<{h6:Gh u*{h;Gh u{hV:Gh u{hw:Gh uzh:Gh uzh:Gh uzh:Gh uzh:Gh uzhd:Gh u(yhH:Gh uyhN:Gh uyh;Gh uxh xh!=Gh u,xh5=Gh uxh5=Gh uxh=Gh uwhJ=Gh uwh=Gh uw } ug=ERuj4h=Gh=Gjiwj4h,>Gh=GjTwu,=bGtG9Grjuvjw1 } Ef  = =ERuj4h=Gh=Gjvj4h,>Gh=Gjv=bGtG9Grju0vfG5Gv5Gv5Gv5Gv5Gv51Gv5QGv5rGv:jv9} #=fGu5Euuuju51G=G55GAG=GVFhVFh uu=GAG?BN>GJ>GF>Gj5F>Gh uuj5J>Gh uuj5N>Gh uu=`Gtj5`Gh uku=Gtj5Gh uMu=dGtj5dGh u/u=hGtj5hGh uu=lGtj5lGh ut=pGtj5pGh ut=tGtj5tGh ut=xGtj5xGh ut=|Gtj5|Gh u{t=Gtj5Gh u]t=Gtj5Gh u?t=Gtj5Gh u!t=Gtj5Gh ut=Gtj5Gh us=Gtj5Gh us=Gtj5Gh us=Gtj5Gh us=Gtj5Gh ums=Gtj5Gh uOs=Gtj5Gh u1s=Gtj5Gh us=Gtj5Gh ur=Gtj5Gh ur=Dtj5Dh ur=Gtj5Gh ur=Gtj5Gh u}r=Gtj5Gh u_r=Gtj5Gh uAr=Gtj5Gh u#r=Gtj5Gh ur=Gtj5Gh uq=Gtj5Gh uq=Gtj5Gh uq=Gtj5Gh uq*rE+Eb>G5iEf>G=GAG+GGR>GV>Gt"5f>GEt %aE5iEEPhx EhE5q E5iEEGG+GG+R>GV>G5qE%aE5EE5ERPhf EhEp X5*ERPh| Eh Ep XPh| EhEp =E0u+E = E0u E = E0u f E  E:$= E0u E = E0u f E E:=E0uE GG+GG+R>GV>GE‹EEVFfhVFh uo=ERtWVQEj>GY^_E hEh uPoE‹EEEVFh[Fh uoR>GVFhVFh unj5Gh un=V>Gu=R>Gw !E !ER>GV>G=!Eu5iEPVEZE=!Eu5EX%&EfcrfcfEfu"f Ejjf5Eh5y E(n j hEh'%5EmE=;Erw;EvEEEEEEKhyFh'%5EmE5 Ejjjjjhh$ Em9 EE%aEkFoFE%aEoFjhoF5kF59 E)njh] EhhXO59 EnXO59 EUmf=XONThXOEXOEj5Eh-%5Elj5Eh;%5Eljh)%5Ekjh*%5Ekjh+%5Ek=ERuhׯFhP%5EvlhFhP%5E_lhFhQ%5EJlh%5EkjPkhX%5EkjPlkhb%5EzkjPTkE EEEEEIhyFhO%5Ekj5EhI%5Ekj5EhK%5Ekj5EhM%5EvkhEh/%5EgkhEh2%5ERkhEh5%5E=khEh9%5E(khEh.%5EkhEh1%5EjhEh4%5EjhEh7%5EjE5 Ejjjjjhh$ Ej9 EE%EkFoFE%aEoFjhoF5kF59 EKk$jh] EhhlO59 Ek59 Ewj9 E=ZEu(=DzF$MFTu=HzFu&FYEM=ERuhFhQ%5EihFhQ%5Ei&FNh%5E%ijPh^f=XOFAjh)%5Ehjh*%5Ehjh+%5Esh=ERuhׯFhP%5EEihFhP%5E.ihFhQ%5Eih%5EyhjPShXOEXOEXOEXOEE2j5Eh.%5Ehj5Eh1%5Ehj5Eh4%5Ehj5Eh7%5EhhhEh-%5EYhhEh;%5EDhhEhO%5E/hhEhI%5EhhEhK%5EhhEhM%5EghX%5EPgjP*ghd%5E8gjPghb%5E gjPfh%5EgjPfAf=XOFAdjh)%5Ezfjh*%5Ehfjh+%5EVf=ERuhׯFhP%5E(ghFhP%5EghFhQ%5Efh%5E\fjP6fXOEXOEXOEXOEE6j5Eh/%5Efj5Eh2%5Eyfj5Eh5%5Eafj5Eh9%5EIfhEh.%5E:fhEh1%5E%fhEh4%5EfhEh7%5EehEh-%5EehEh;%5EehEhO%5EehEhI%5EehEhK%5EehEhM%5E}ehX%5EdjPdhd%5EdjPdhb%5EdjPdh%5EdjPodhFhP%5EehFhQ%5EdhEh/%5EdhEh2%5EdhEh5%5EdhEh9%5EdhEh.%5EdhEh1%5EpdhEh4%5E[dhEh7%5EFdhEh-%5E1dhEh;%5EdhEhO%5EdhEhI%5EchEhK%5EchEhM%5Ecjh)%5Ebjh*%5Ebjh+%5EbhX%5EbjPbhb%5EbjPbh%5EbjPbÐ`CE=Et =Eu!jhjjjhhEVcEf@zFfDEBzFFE=*DUu1GGE5GET=m!FRu,EESEE‹EGEEEEEGEEyFKEzFEyFOEyFSEzFWEx'zFgEi'WEwE =yFu xExE =yFu yE yEӡ~Ft,FFFzEEE‹EzEEzF~EWVQEDzF>Y^_=xEt=KEu =EtjhEhhCE5E_ba`>u#`=ERu;E;E a>u#`=ERu;E;E aT>u#`=ERu(s*u;`=ERuXu#`=ERu;E;Ea>u#`=ERu;E;EaT>u#`=ERu(s*u;`=ERuXC5[} EEE ZbH5H[E` HuFau uu[EPjuh[EPhEjjuU\}uEEPP6uFPXuEEPPEEPPEPPEU쐐U܃}ujW>ZjXEu_Z uEEPEPPEPEPPjXuNZh PuYEjZu3Zh PuYE3+EEuuuY u uYEuu Z uuYuYEjuuujuujjuEPP yEPuYuYX=@u=Wu=u =@uPYuuzYuHYE`xF|F^nOF KEF |Fyu5F5FB,yu5F5FByu5F5FByu5F5FByu5F5FByu5F5FBy u5F5FBy u5F5FBkyu5IJF5ȲFBRyu5̲F5вFB9yu5ԲF5زFB ARܲF3Z5ܲF5FB9u B YES 9u B NO RL3ZB hA$?Rh2ZAART2ZARF2ZA$?R,62ZAAR'"2ZAR"2ZAF`FFEEƋEVF3 aA `FFEEƋE|VFB axF=xFt|FFRjjjjjhh$ EU9 ED@@EEDE5EE5E#EjhE5E59 EUjh] EhhpO59 EUxF =EHE xFt =lOFomS = KEGPT =nOEFI =ERuE rO]>ErO>Ey sO?EjsOV?E[ tO?ELaU} IEJF=ERhGh"5JFnShGh"5JFYShGh"5JFDShGh"5JF/ShGh"5JFShGh"5JFShGh"5JFRhƦGh"5JFRh Gh"5JFRh{Gh"5JFRhɧGh"5JFRhGh"5JFRh2Gh"5JFrRhGhr"5JF]R=DCuzhG5JFVRhGh"5JF/RhRGh"5JFRhGh"5JFRjh"5JFQjjh"5JFQi=DKuhGuQNhGuQhGh"5JFQhGh"5JFQhѪGh"5JFsQhתGh"5JF^QhGh"5JFIQhGh"5JF4QhGh"5JFQh2Gh"5JF QhiGh"5JFPhGh"5JFPjhЦGh"5JFPh٦Gh"5JFPhަGh"5JFPhGh"5JFPhGh"5JFrPhGh"5JF]PhGh"5JFHPhGh"5JF3Ph=Gh"5JFPhGh"5JF PhGh"5JFOh Gh"5JFOhYGh"5JFOhGhr"5JFO=DCuihGuOhGh"5JFOhoGh"5JFuOhGh"5JF`Oh"5JFNjPN=DShGu;Oh Gh"5JFOh6Gh"5JFNhRGh"5JFNh=Gh"5JFNhxGh"5JFNhGh"5JFNh#Gh"5JFNhgGh"5JFNhGh"5JFlNhϭGh"5JFWNhSGuWNh Gh"5JF0Nh6Gh"5JFNhRGh"5JFNh=Gh"5JFMhxGh"5JFMhGh"5JFMh#Gh"5JFMhgGh"5JFMhGh"5JFMhϭGh"5JFsM/E0E1E2E3E4E5E6Ejhj"5JF7Ljhk"5JF%Ljhl"5JFLjhm"5JFLjhn"5JFKjho"5JFKjhp"5JFKjhq"5JFK E02hhEhj"5JFL=E.uhk"5JFKjPKH5 EE5 EE5 EE5 EE5G4E5G8E E1a2hEhk"5JFK=E.uhk"5JFSKjP-KH5 E<E5 E@E5 EDE5 EHE5G`E5GdE E21h\Ehl"5JFpK=E.uhl"5JFJjPJH5 EhE5 ElE5 EpE5 EtE5GE5GE E3I1h֯Ehm"5JFJ=E.uhm"5JF;JjPJH5 EE5 EE5 EE5 EE5GE5GE E40hPEhn"5JFXJ=E.uhn"5JFIjPIH5 EE5 EE5 EE5 EE5GE5GE E510hʲEho"5JFI=E.uho"5JF#IjPHH5 EE5 EE5 EE5 EE5GE5GE E6/hDEhp"5JF@I=E.uhp"5JFHjPqHH5 EE5 EE5 E E5 E$E5G<E5G@E E7/hEhq"5JFH=E.uhq"5JF HjPG]hEhq"5JF|H5 EDE5 EHE5 ELE5 EPE5GhE5GlEj/EffPhj"5JF'Gj0EffPhk"5JF Gj1EffPhl"5JFFj2EffPhm"5JFFj3EffPhn"5JFFj4EffPho"5JFFj5EffPhp"5JFyFj6EffPhq"5JF\F=/Et?=0Et6=1Et-=2Et$=3Et=4Et=5Et =6Euhr"5JFdFjP>Fhr"5JFJFjP$F=GCt&jhb"5JFEjha"5JFE$jhb"5JFEjha"5JFE=8ECt&jh{"5JFtEjhz"5JFbE$jh{"5JFNEjhz"5JFBj5Ehd"5JF&Bj5Ehe"5JFBGG@hyFhy"5JFAj5Ehv"5JFAj55Ghw"5JFAj59Ghx"5JFAjPhs"5JFAjPht"5JFqAjPhu"5JFYA E!G } uj5JF@ }  Ef  ="u1jjh"5JF@h"5JF_@jP9@w ="u1jjh"5JF@h"5JF'@jP@? =j"/E0E1E2E3E4E5E6E E0!G0&5 EE5 E5G5 E9G5 E1G5 EG5 EG =k"/E0E1E2E3E4E5E6E E1!G1%5 EE5 E5G5 E9G5 E1G5 EG5 EG =l"/E0E1E2E3E4E5E6E E2!G2T%5 EE5 E5G5 E9G5 E1G5 EG5 EGEG =m"/E0E1E2E3E4E5E6E E3!G3$5 EE5 E5G5 E9G5 E1G5 EG5 EG =n"/E0E1E2E3E4E5E6E E4!G4$5 EE5 E5G5 E9G5 E1G5 EG5 EG=o"/E0E1E2E3E4E5E6E E5!G5\#5 EE5 E5G5 E9G5 E1G5 EG5 EGMO=p"/E0E1E2E3E4E5E6E E6!G6"5 EE5 E5G5 E9G5 E1G5 EG5 EG=q"/E0E1E2E3E4E5E6E E7!G7 "5 EE5 E5G5 E9G5 E1G5 EG5 EGhr"5JF:jP:ha"5JF:jP:hb"5JF:jP|:hc"5JF:jPd:hd"5JFr:jPL:he"5JFZ:jP4:hf"5JFB:jP:hs"5JF*:jP:ht"5JF:jP9hu"5JF9jP9hz"5JF9jP9h{"5JF9jP9hv"5JF9jP9hw"5JF9jPt9hx"5JF9jP\9hy"5JFj9jPD9GGGGhyFhy"5JF9GG5 EBE5 EEEj5Ehv"5JFv9j5Ehw"5JF^9j5Ehx"5JFF9jjhc"5JF29jjhd"5JF9jjhe"5JF 9jjhf"5JF8=g"uJ`atj5JF/8h;Ehi"5JF8h`uPhh"5JF8;=a"uGC蔾#=b"uGL| =z"u8ECC={"u8EL+=r"GL0=DCjFh0Jh~"5JF7%Gh"5JF7uDK0JHO %G#jjh"5JF57EG0JHO=EG %GjhGhs"5JF7hG9AGjh$Ght"5JF6=)Gt3jh-Ghu"5JF6h-G8%GEG=vDj05AG5=Gj6jjht"5JF6jfhhu"5JF6pWVQHEEQY^_jPhHEhi"5JF)6jjjjjhhHE6EkFoFjhoF5kF5E875aE;AGs.j05G5Gj5jjhs"5JF6AG%aEkFoFjhoF5kF5E6HOBjh] EhhHO5E65E5!G EıG$zEƍƱGh±G5jhjjjh@h±G5߱Gjjjjjhh E{5GG%aEEE G aEEjhE5E5G5G+GG G)G-G1G5G9GRFjh#@uh7D5 E3l{P=DKtdC'@hEjjPjj4 `1G5GGE‹EEEGPGPG|AA5 EGf !EfGWVQG7!E Y^_WVQGP!E Y^_WVQGp!EY^_fG G fG G WVQeGE Y^_WVQqGEY^_WVQuGE Y^_WVQGEY^_WVQGEY^_WVQQGE Y^_WVQ[GE Y^_G a`G GGG%aEEE G aEEjhE5E5Gz30Ijh] Ehh0I5GC3=] EGG%aE`0I=EGHO5EG %GaGGGG5G5GhG Eh̡G2١G GG 9GBE 5GEE5EhL EhڡG1 G-5Ehf EhG1 G-5Ehm EhG1 G jhEjh̡G5߱G32-1G5G=5Gu =1Gt79G=GGGG=GI5GhG EhG0 G WVQbG±GY^_WVQG`uPY^_RFj@hGhGj405߱G0߱G5G0GaQVWyFWVQyFyF Y^_ +yFyF yFhyF PyFhyF  yFY_^YÍIUĤ} 4E$߃C=P0 kGE$߃C=P0kG=ERhWGh un/hWGh u\/h6WGh uJ/hOWGh u8/hWWGh u&/h[WGh u/hcWGh u/hjWGh u.hWGh u.hWGh u.hWGh u.hWGh u.hWGh u.hVGu.hWGh ur.hWGh u`.h"XGh uN.h0XGh u<.h9XGh u*.h=XGh u.hBXGh u.hIXGh u-hdXGh u-hmXGh u-hyXGh u-hXGh u-hXGh u-hWGu-hs\Gh u{-hs\Gh ui-hs\Gh uW-hs\Gh uE-hs\Gh u3-hs\Gh u!-hs\Gh u-hs\Gh u,hs\Gh u,h uN,jP(,h u9,jP,h u$,jP+h u,jP+h u+jP+h u+jP+h u+jP+h u+jP+h u+jP+h u+jPk+h u|+jPV+h ug+jPA+h uR+jP,+h u=+jP+h u(+jP+ffGjh u*jh u*jh u*jh u{*jh ul*EfG} uf?fG=ERuWVQXGXGY^_WVQXGXGY^_hXGjh5`E*ju;*F} 0Ef =  EfG0YGkGkGWVQkGkGY^_j h8Gh u)8G7gG;gGj h8Gh u)8GSgGWgGju) f= Ujjh uy)+gGjjh uc)/gGjjh uM)3gG+gG  E/gG  E 3gGI7gG;gGhyFh u);gG;OgGru7gG;KgGvhj5?gGh uS)j5CgGh u>)j5GgGh u))KgGOgG[hyFh u )KgGOgG+7gG;gG@SgGWgGhyFh u(! ' f= 3j h8Gh u(8GM7gG;gG; Ewr; Ew;OgGw r4;KgGv,7gG;gGhyFh u<(7gG;gG  EB3gG  E/gG+gGj5+gGh u'j5/gGh u'j53gGh u'KgGOgG+7gG;gGSgGWgGhyFh u' f= jjh u& EI;rQjQh uE'Y?gGjjh u&  EI;rQjQh u'YCgGjjh us&wjjh u& E;rQjQh u&YGgG?gG  ECgG  EGgGKgGOgGhyFh ut&KgGOgG+7gG;gGpkj5?gGh u2&j5CgGh u&j5GgGh u&KgGOgG:hyFh u%SgGWgGhyFh u%# f= j h8Gh u%8GIKgGOgG; Ew EI;r- E EKgGOgGhyFh uH%  EBGgG  ECgG?gGj5?gGh u%j5CgGh u$j5GgGh u$KgGOgG;;gGr;7gGwmj5?gGh u$j5CgGh u$j5GgGh u$KgGOgGhyFh uf$KgGOgG+7gG;gGthyFh u&$f= j h8Gh u#8GSgGWgG7gG;gGH; Er9; Er1 E+7gG E+;gGSgGWgG EH EKgGOgG  EBGgG  ECgG?gGj5?gGh uP#j5CgGh u;#j5GgGh u&#KgGOgGXhyFh u #mf= c=gGAU<=gG%jhfGh u:"=fG=fGt;=ERuj0hTGhUGuI"j0hTGh8UGu0"=fG8r;=ERuj0hTGhUGu"j0hTGh8UGu! fGfG:kGu;=ERuj0hPGhRGu!Mj0hQGhRGu!4:kGu;=ERuj0hPGh QGut! j0hQGhQGu[! E=tFf=h EFluv=ERuj0hPGhSGu!j0hQGhSGu!=ERuj0hPGhzUGu xj0hQGhUGu _jjh u jjh u jjh u jjh u  EHjPh u  EHjPh u j5 Eh u{ jjh uj  E% E% ESgGWgGKgGOgGuhyFh u' SgGWgGShyFh u h uhjPBh uSjP-h u>jPh u)jPh ujPh ujPh ujPh ujPh ujPh ujPh ujPph ujP[h uljPFh uWjP1h uBjPjh ujh uhs\Gh uh ujPffGhs\Gh uehs\Gh uShs\Gh uAhs\Gh u/hs\Gh uhs\Gh u hs\Gh uhs\Gh uhs\Gh uh u8jPh u#jPh ujPh ujPh ujPh ujPh ujPh ujPh ujPjh u{jPUh ufjP@h uQjP+h u<jPh u'jP gG I`fGlgG7gG;gGfGfGSgGWgGfGfGfGfGjjjjjhh[gGjngG7gG%aEkFoF;gG%aEoFjhoF5kF5ngG=fGjh2DhhFK5ngG8F0u FWVQE} E Y^_^>% EkFoFjhoF5kF5 Ejh] E5 Eh2J5 EWVQ E2JY^_tWVQ EE Y^_9=ERuWVQ E E Y^_WVQ E E Y^_5 E EU} gE*pGjhhu8Ehu y E3Pjh 5y E fEjjf5Eh5y E jE=ERunhpGhu hpGhu hpGhu hpGhux hpGhuf hpGhuT lhqGhu@ hwqGhu. hqGhu hqGhu hqGhu hqGhu } u j: y} u^Ef _=uA=ERuj4hlGh@lGjP j4hAnGhpnGj; j } =fGu5Eu uj fGfGu   EBN>G  EJ>GF>Gj5F>Ghu j5J>Ghu j5N>Ghu fGfGhyFhu fGfGhyFhut fGfGhyFhuR fGfGu fGfG5 EfGSgGWgGu 5iEȺfGfEjjf5Eh5y E l E+E`FL8FhujP{hujPfhEhuhueP=ERuhrFu hFu U} gE*pGjhhuEhuy E3Pjh 5y E?fEjjf5Eh5y EE=ERunhADhuhDh uhֹDh uhDh uhDuWVQEEY^_lhhDhuh˹Dh uhDh uvhDh udh6DuiWVQEEY^_^} u jL} uZEf 2= u==ERuj@hkGh@lGjjKj@hnGhpnGjj1} =fGu5Eu<ufGfGhyFh usfGfGhyFh uQfGfGu K%&E5fGfEjjf5Eh5y EE+EȡfGfGEfGfG5E5iEE5ERPh| EhE X5*ERPh| Eh E XPh| EhE =E0uE = E0u f E  E:= E0u+ E = E0uf E =E0uE  E:hEhu `5 E0ᣥFFF 8P5F5F>0P=F=F=F=FWu9D|<9D|4 2P5F5F5F5FV9D 9D}F=F?FW 8P=F=F !EϼF !E:8P=F=F%!EEqP5=EBEDrP5=Ea`=Gjhjjjh@htGGu==ERujh Gh Gjjjh\ Ghy Gjj}=ERujhE5GhG5GjhE5GhG5GjhE5^GhG5G^G;Et==ERujhPGh GjJjjhlGhGj0ja`F$F$5F8PFF0PFFEBE 2PFFEBE9PFF`:PFF ;PFF;PFFjh] EhhO5 EaE9] Ef=OU E$ME]EME0PMEMEyEB E$ QE]EQEOQE`O=QEa]Ea`t:t1t(t t t  iE}E aEEEjhE5E5 EO-=jh] EhhO5 ExaE9] Ef=OU E$ME]EME0PMEME}E E$ QE]EQEOQE`O=QEa]Ea`t:t1t(t t t  mEE aEEEjhE5E5 E\O;jh] EhhO5 E%aE9] Ef=OU E$ME]EME0PMEMEE E$ QE]EQEOQE`O=QEa]EaU쐐} =ERu)hFuhFhukhѿFhuYh߿FhuGhFhu5hFhu#hFhuh,Fhuh=Fh uhRFh!uhFh"uhFh-uhFh.uhFhuhFhuhFhuohFhu]h FhuKh'Fhu9hDFhu'haFhuh~FhuhFhuhFhuhFhuhFhuh*Fh uh|FhuhFhuhFhushFh uajEffPhuWjEffPhu=jEffPhu#jEffPhu jEffPhujEffPhujEffPhujEffPhujEffPhujEffPhumjEffPhuSjEffPhu9jEffPhujEffPhujEffPhujEffPhujEffPhujEffPhuj EffPhuj EffPhuij EffPhuOj EffPhu5j EffPhujEffPhuhEhujEffPhuhEhujEffPhuhEhujEffPhu}hEhu[jEffPhuQj EffPhu7j EffPhuj EffPhuj EffPhuj EffPhujEffPhujEffPhujEffPhujEffPh ugjEffPhuMjEffPhu3jEffPhuhuljPFhuWjP1huBjPhu-jPh ujPh uP} uEju} uEf= X`jhVEh uVEF%FߢF%FjPhu)PhujPhEhu=hujjhPIu0u F=CF tWVQjFCF Y^_=EF tUWVQjFEFY^_nF WVQoFIFY^_rF WVQsFLFY^_SWVQjFDFY^_nF WVQoFIFY^_rF WVQsFLFY^_ajF Ë`2JBG1G%aEkFoFjhoF5kF59 EG+1G@VE;ErEE%aEjEjh] E5jEh2J59 E褹pNG= GWVQGXG Y^_1GPhB EhG趸 G|1G?BPPhm EhG臸 G XRPhT EhG_  G-XPhf EhGD G-5GhGh'G% ,G "D7hh59 Ejjjjjhh$ E9 E-/GWVQGG Y^_1GPhB EhG虷 G|1G?BPPhm EhGj G XRPhT EhGB  G-XPhf EhG' G-5GhGh'G ,G "D7gjh3QD5FhJE5 Eֵ59 EͶjjjjjhh$ E9 EGƜE%] E=] Eu H 5aEnEEHaHU} g=ERh;HuhhHhRuܵhHhSuʵhHhUu踵hHhVu覵hHhXu蔵hHhYu肵hHhZuph;Hh]u^hUHh`uLh}Hhau:hHhju(hHhkuhHhtuhHh~u hHuh,HhRuδh[HhSu輴hrHhUu誴hHhVu蘴hHhXu膴hHhYuthHhZubh Hh]uPh Hh`u>hEHhau,hQHhjuhjHhkuhHhtuhHh~uh[uGjP!hXu2jP hYujP E02J h_ Ehlu耳=_ E u,hbuڲjP贲huuŲjP蟲=2JEthuu襲jP E12J jh_ Ehmu=_ E u,hcubjP<hvuMjP'=2JEthvu-jP E22J h_ Ehnu萲=_ E u,hdujPıhwuձjP诱=2JEthwu赱jP菱 E32J zh_ Ehou=_ E u,heurjPLhxu]jP7=2JEthxu=jP E42J h_ Ehpu蠱=_ E u,hfujP԰hyujP述=2JEthyuŰjP蟰 E52J 芗h_ Ehqu(=_ E u,hgu肰jP\hzumjPG=2JEthzuMjP' E62J h_ Ehru谰=_ E u,hhu jPh{ujPϯ=2JEth{uկjP误 E72J 蚖h_ Ehsu8=_ E u,hiu蒯jPlh|u}jPW=2JEth|u]jP7hTuHjP"hWu3jP h]ujP6} u j$} Ef =~h`uɮjjhP87Hj h8GhTu譮8G~H#Hj h8GhWu脮8G~'H+Hh]uVjjhPŮtH/H#H3H)j h8Gh[u$8GT~/H3Hju=bu E0=cu E1=du E2k=eu E3V=fu E4A=gu E5,=hu E6u=i E7 E E= E0uhuu)jP= E1uhvu jP= E2uhwujPǬ= E3uhxuϬjP詬= E4uhyu豬jP苬= E5uhzu蓬jPm= E6uh{uujPO= E7uh|uWjP1*jjhTuìhTu,jP Ej5 EhWu蓬hWujP֫hXujPhYuҫjP謫jhXu[jhYuL= E th~u薫jPp=XujjhWu=Yu+jjhWuܫhWuEjPR=uu& E0hbujP4%=vu& E1hcujPʪ=wu& E2hduêjP蝪=xu& E3heu薪jPp=yu& E4hfuijPCq=zu# E5hgu<jPVG={u# E6hhujP,=| E7hiujP辩 E Eh]uũjP蟩= E t;h~u觩jP聩j h8GhTu藩h8Gh[u =]h]u\jjhP˩t&h[u;jPjh[u贩;h[ujPj h8GhTuh8Gh[uw `H1G1G8G'WVQH8G Y^_'HGG8G&WVQ)H8G Y^_/HHH8G&WVQH8G Y^_=ERuWVQHHY^_WVQH HY^_WVQH< HY^_WVQ9HHY^_WVQgHn HY^_WVQH H Y^_WVQH H Y^_WVQH HY^_WVQH H Y^_WVQH H Y^_WVQH HY^_WVQH> H0Y^_WVQjH HY^_WVQ H HY^_WVQ0HdH0Y^_WVQHH0Y^_pWVQHHY^_WVQH$ HY^_WVQHU HY^_WVQ9HHY^_WVQgH HY^_WVQH H Y^_WVQH H Y^_WVQH HY^_WVQH H Y^_WVQH H Y^_WVQH HY^_WVQHp H0Y^_WVQjH- HY^_WVQ H HY^_WVQ0HH0Y^_WVQHH0Y^_ E EWVQHh EY^_ E5 EHjjjjjhh$ Eϥ9 E E EɋWVQJHh EY^_ E EbHjjjjjhh Ez E=7HtOjhjjjh@hVGPpGkFoFjhoF5kF5pG軥+hVG+jhjjjh@hVGpGjhE5HhH5pG菥HkFoFjhoF5kF5 E/Ejh] EPh2J5 E)E1GH H H H HjfGWVQHk H Y^_WVQH~ H Y^_WVQH H Y^_ 1G5G1G8G`!WVQH8G Y^_1G?GgGCgG?gG5?gGhL EhHk H 5CgGh& EhHL H 5GgGh" EhH- H 5GhL Eh{H jhEj4hH5pG辣jhE5HhH5pG衣j@h HhHjPjaÐU}  =ER h Huph Hh3 uLh Hh4 u:h% Hh6 u(h. Hh8 uh6 Hh: uhB Hh< uhJ Hh@ uhS HhB uΡhc HhF u輡hv HhJ u誡WVQa H! H Y^_WVQu H+ H Y^_WVQ H5 H Y^_h Hueh Hh3 uAh Hh4 u/h Hh6 uh Hh8 u h Hh: uh Hh< uh Hh@ uՠh HhB uàh HhF u豠h HhJ u蟠WVQa H? H Y^_WVQu HI H Y^_WVQ HS H Y^_jjh; uCjjhC u2jjhA u!jjh= ujjhG uj hk Hh Hjjj萠s H jhhuߟEh2 u1y EfEjjf5Eh5y E膟3Pjh 5y EhEx} u jğf} Ef H=J bju~WVQHk H Y^_WVQH~ H Y^_WVQH H Y^_ 1G5G1G8GWVQH8G Y^_1G?GgGCgG?gG5?gGhL EhH蛞 H 5CgGh& EhH| H 5GgGh" EhH] H 5GhL Eh{H> jhEj4h0H5pGjhE5HhH5pGўj4} =fGuQ5Eu?fdfEjjf5Eh5y EnjjhA uiu蕜d1G8Gh8Gh; uA1G?BGgGCgG?gGj5?gGh5 uj5CgGh7 uj5GgGh9 u͜jE+Eb>G5iEf>G5ERPh| Eh~ Hœ X5*ERPh| Eh H袜 XPh| Eh H莜 =~ H0u~ H = H0u f H  H: H:+= H0u H = H0u f H  H: H 1G5G+H#H H Ht"5f>GEt %aE5iEEPhx EhE輛 'H+H+1G5G H Hu =E5EE5ERPhf Eh HK X5*ERPh| Eh H+ XPh| Eh H = H0u+ H = H0u H = H0u f H  H:$= H0u H = H0u f H  H: H8G8h8GhA u[ha Hh1 uIWVQH~ H Y^_WVQH H Y^_E8GWVQEH8G Y^_h8GhC u H8Gh8Gh= u™ H8G~ H8Goh8Gh= u蒙j5GhG uw H8G9 H%&E H H H%&E H H H` H H)fEajjf5Eh5y E U} =ERu3hDu֘hDhu貘hDhu蠘1hѺDu裘hDhuh6Dhum4E$߃C=P H H0`uP$߃C=P H H0 E02J b~h_ Ehu= H0t= H0t=_ E t =2JEuhu?jP E12J ~h_ Ehu袗= H1t= H1t=_ E t =2JEuhujP軖 E22J }h_ EhuD= H2t= H2t=_ E t =2JEuhu胖jP] E32J H}h_ Ehu= H3t= H3t=_ E t =2JEuhu%jP E42J |h_ Ehu舖= H4t= H4t=_ E t =2JEuhuǕjP衕 E52J |h_ Ehu*= H5t= H5t=_ E t =2JEuhuijPC E62J .|h_ Ehu̕= H6t= H6t=_ E t =2JEuhu jP E72J {h_ Ehun= H7t= H7t=_ E t =2JEuhu譔jP臔} ujux} Ef =jhuUjjhPĔ<t  E0Rhu)jjhP蘔<t  E1&hujjhPl<t  E2huѓjjhP@<t  E3hu襓jjhP<t  E4huyjjhP<t  E5vhuMjjhP輓<t  E6Jhu!jjhP萓<t  E7ju `jjjjjhh E蜓 E E>%aEkFoFjhoF5kF5 Ejh] Ehh2J5 EѓWVQ2JtEY^_t^ E=ERuEj1hEhEj|JEj1hEhEjbt5 Eʒ E{>%aEkFoFjhoF5kF5 E8WVQ2J EY^_jh] Ehh2J5 E#n5 EM EaU} =ERu3hfDuhDhuӑhDhu1hDuđhDhu蠑h6Dhu莑 E02J wh_ Ehui=2JEthuÐjP蝐 E12J wh_ Ehu&=2JEthu耐jPZ E22J Ewh_ Ehu=2JEthu=jP E32J wh_ Ehu蠐=2JEthujPԏ E42J v=2JEthuɏjP裏h_ Ehu? E52J |v=2JEthu膏jP`h_ Ehu E62J 9v=2JEthuCjPh_ Ehu蹏 E72J uh_ Ehu蔏=2JEthujPȎ} uju蹎} Ef =jhu薎jjhP<u  E0hujjjhPَ<u  E1chu>jjhP譎<u  E27hujjhP聎<u  E3 hujjhPU<u  E4hu躍jjhP)<u  E5hu莍jjhP<u  E6hubjjhPэ<u  E7[ju! `t1=ERujhFhFjPjhFhFj;aÍI`jjjjjhh E蠍 E=uq5 E} E E=ERuEjhEhEjՌvEjhEhWEj軌5E(hEBjG>%aEkFoFjhoF5kF5 E葍2Jjh] Ehh2J5 EZ>%aEkFoFjhoF5kF5 E8WVQ2JtEY^_jh] Ehh2J5 E#n5 EM Ea`WVQFF#Y^_WVQ>FF#Y^_5EEEEFFFwG=ERujhFhFj>Fgjh\FhsFjFHWVQFF#Y^_WVQ>FF#Y^_eEFjh!h5FƊa`jjjjjhh$ E9 EjFNkDt59 Eߊ9 Ea`G H H H%aEkFoFjhoF5kF59 E=jh] EhhlO59 E=ZE5=DzF$Log%=DzF$Top=DzF$Txf=DzF$Ext=DzF$Vol=DzF$Att=DzF$Bit=DzF$Boo=DzF$Bad=DzF$Sec=DzF$UpC=DzF$Extu=DzFMoune=DzFtracU=DzFWPSeE=DzFInde5=yFtC=yFtfEKfEAGEfEKfEDKE=yFt<=DzF$MFTt^fEFfEAEyFEzF#E.fEFfED EyF'EzF+Ef=DzF$Iuu`=yFt*=DzF$MFTt:EyFEzFEEyFEzFE5 HSE$ H H]a`h$5DGjP!h$5D/jP h$5DjPh$5DjPنh$5DjPh$5DφjP詆h$5D跆jP葆h$5D蟆jPyhr$5D臆jPahs$5DojPIht$5DWjP1hu$5D?jPhv$5D'jPhw$5DjPhx$5DjPхhy$5D߅jP蹅hz$5DDžjP衅h{$5D诅jP艅h|$5D藅jPqh}$5DjPYh~$5DgjPAh$5DOjP)h$5D7jPh$5DjPh$5DjPI|Ff>?F%SD7KDPjPhr$5DN%SDYjPhs$5D0jh$5D4f>F%SDKDPjPht$5D%SDYjPhu$5DDŽjh$5D˃f>aF%SD[KDPjPhv$5D|%SDYjPhw$5D^jh$5Dbf>F%SDKDPjPhx$5D%SDYjPhy$5Djh$5Df>F%SDKDPjPhz$5D誃%SDYjPh{$5D范jh$5D萂f>&F%SD KDPjPh|$5DA%SDYjPh}$5D#jh$5D'f>F%SDKDPjPh~$5D؂%SDYjPh$5D躂jh$5D辁f>tnF%SDu`KDPjPh$5Dw%SDYjPh$5DYjh$5D] H  Ha`fFft}F 7V F`PhFhBF+ a`RhFhFF aBF >0u FEFVFfFFfXFHFZFfIFf\FKF^FfLFf`FNFbF VF=EF t7WVQjFEFY^_rF WVQtFMFY^_SWVQjFEFY^_nF WVQnFFFY^_oF WVQtFMFY^_a`=8ELujj hEh#5h{P6hED;EvEE+E@$5EE5EEEEOj hEh#5h{PhEځu E+ EA;rEEHEj5Eh#5h{PENDhNDh#5h{Pa`j hEh#5h{P>hEL;EvEjPh#5h{PEEE EBE EEEEE\hyFh#5h{P8aËU=RFuRFjul~} 7 =ERu$hFuhFh#u~h-Fu~h+Fh#u~h7Fh#u~hVFh#u~hmFh#u~hFh#us~hFh#ua~hFh#uO~hFh#u=~hFh#u+~hnFh#u~hDh#u~hDh#u}hDh#u}Eh{Ph#u=}F5ٵFjh5F}h;Eh#5h{P}h`uPh#5h{P} E0c=E.uh#5h{P|jP|h_ Eh#5h{PD}5 EE5 EE5 EE5 EE5 E E5 E$E E1@ch_ Eh#5h{P|=E.uh#5h{P2|jP |5 E<E5 E@E5 EDE5 EHE5 ELE5 EPE E2bh_ Eh#5h{PQ|=E.uh#5h{P{jP{5 EhE5 ElE5 EpE5 EtE5 ExE5 E|E E3,bh_ Eh#5h{P{=E.uh#5h{P{jPz5 EE5 EE5 EE5 EE5 EE5 EE E4ah_ Eh#5h{P={=E.uh#5h{PzjPnz5 EE5 EE5 EE5 EE5 EE5 EE E5ahEh#5h{Pz=E.uh#5h{P zjPy5 EE5 EE5 EE5 EE5 EE5 EE E6`hEh#5h{P)z=E.uh#5h{PyjPZy5 EE5 EE5 E E5 E$E5 E(E5 E,E E7`=E.uh#5h{P yjPxhEh#5h{P~y5 EDE5 EHE5 ELE5 EPE5 ETE5 EXEj'EffPh#5h{P)xj(EffPh#5h{P xj)EffPh#5h{Pwj*EffPh#5h{Pwj+EffPh#5h{Pwj,EffPh#5h{Pwj-EffPh#5h{P{wj.EffPh#5h{P^wjh#5h{PLwjh#5h{P:w='Eu0 E05EE5 EE5$E E{=(Eu0 E15<EE5LEE5PE EB=)Eu0 E25hEE5xEE5|E E =*Eu0 E35EE5EE5E E=+Eu05E E4E5EE5E E=,Eu- E55EE5EE5E Ea=-Eu- E65EE5(EE5,E E+ E75DEE5TEE5XE EE1 E2h" EhuUvDD ExE EtEpEDDJShyFh#uuj5Eh#5h{Pu E E} uj5h{Pu} Ef =#ua'E(E)E*E+E,E-E.E E0 E0[5 EET=#ua'E(E)E*E+E,E-E.E E1 E10[5 EEn=#ua'E(E)E*E+E,E-E.E E2 E2Z5 EE=#ua'E(E)E*E+E,E-E.E E3 E3`Z5 EE=#ua'E(E)E*E+E,E-E.E E4 E4Y5 EE6=#ua'E(E)E*E+E,E-E.E E5 E5Y5 EEL=#u^'E(E)E*E+E,E-E.E E6 E6(Y5 EEi=#'E(E)E*E+E,E-E.E E7 E7X5 EEE E EHFFBFEXBF1 Eh" Eh5h{Pr+=#u#=#u8EL=#u8EK=#u@`gDh`uPrh`uPh#5h{Pqh;Eh#5h{Pqa=#fFFPWVQHEEQY^_jPhHEh#5h{PpjjjjjhhHE^qEuZ`=ERuj4hnEhHEjpj4hEhEjpajjjjjhhHEpEWVQ;EHEQY^_ E Ejjjjjhh Ep EE%aEEE G aEEjhE5E5 EqEJENERERFjhMkDuhE5 Eol{PnDhEjjPjj2p U} EDj5Dhuoj5Ghuojhun=ERu{h Husoh HhuOohA Hhu=oh^ Hhu+ohh Hhuoht Hhuoh Hhunyh Hunh Hhunh HhunhHhunhHhunh(Hhunh:Hhuzn} ujum} Ef =PjhaGhumhaGoD;GjhaGhuimhaGwoDt}G+D@9D~1Dj5Dhumj5DhumlZHhuljjhPbmTHjjjuOm4j5GhuDmDj5Dhu%mXp=uMDfGDZHhuhljjhPlTHjjjul=uZHjjjul U} 4HjhhulEhiuky EfE3Pjh 5y E#ljjf5Eh5y EllEjjhkukjjhlukjjhmukjjhnukjjhoukjjhpukjjhqukjjhrukjjhsuqkjjhtu`kjjhuuOkjjhvu>k=ERuWVQEEY^_hHu$kh HhjukhHhhujhHhujh,HhujhFHhujhJHhujhQHhujhYHhujhiHhupjhHhu^jhHhuLjhHhu:jhHhu(jhHhujhHhujh.Hhuih[HhuihtHhuih~HhuihHhuihHhuihHhuihHhutihHhubi} uK5EihEi5bGmihIGi5HXihHrijwi} Ef =j E Eu~`=ERuj4hHhHjshj4hbHh|Hj^hat_5EhhEh5bGhhIGh5HhhHhjhHfGuig} =Hu5Eugu8g=fGu 5E'hj5Ehlugj5 EhmugE EjPhkugj5Ehougj5Ehpu|gEEjPhnuagE#E5EM FjPhru;g'E+E5EM FjPhsugj5M Fhqufj5GEhuufj5KEhvufGEKEjPhtuf1G+GjPhuf1GjPhuf1G?BHHHj5HhuFfj5Hhu1fj5Hhufj5Ghuf1G+G%&E5HfEjjf5Eh5y EeUfE+E8ȡ1G+GEE%EjPhubeG+1GHjPhuBeH5E5iEE5ERPh| EhEt1G;r V;sELE a`I|FF>t9F%EGWF%EGGW a`jhh$jdHjjjjjhh Gc(GkFoFDH%PHkFoFjhoF5kF5(G/dGDGjh] EjhG5(GcGWVQGGY^_GWVQGGY^_=] EQGD;G:G%EHG%EGGGGjhG5G5yGScGGGjh] E5GP5yGc`5G/u->\u->>u FjhkGbhkGb=XHt[UH5UHh. Eh]Ha bH.jhjjjh@hYHa=XHtHm=kGSmartWVQHGY^_H{H{HPh. EhqHca vH.jhjjjh@hgHOatH\HPhf EhH!a H.jhjjjh@hH au\H븣;Fjh] E5H5G5;Fa5;F`Nj`fG=ERu1WVQHEY^_j@hHhHj`j`WVQHEY^_j@hjHhHj_jx`aU} BfGjhhu_EhuC_y E3Pjh 5y E_fHjjf5Hh5y Ez_#`E=ERu\hiHh ug_hsHh uU_hHh uC_hHuH_WVQEEY^_ZhHh u _hHh u^hHh u^hHu^WVQEEY^_} u j_} u$Ef = uj^} =fGu5Eu]u]=fGuj^^E+EnG_HJG+GHRPh| EhE] X<RPh| Eh E] XPh| EhE] =E0uE = E0u f E  E:= E0u E = E0u f E  E:j5Gh u]j5Gh u]hEh u\GdGt#fHjjf5Hh5y E\ `EẠ|OЊu Ƃwu Ƃiu Ƃ[u ƂMu Ƃ?u Ƃ 1 u Ƃ # u Ƃu ƂƂa`EẠ|OЊt ƂƂaU쐐} k`hEh#u[j5Eh!u[j5Eh'u{[j5Eh(uf[j5Eh)uQ[=ERu{hFuS[h2Fh*u/[hCFh+u[hVFh,u [hjFh-uZhzFh.uZhFh%uZyhFuZhFh*uZhFh+uZhFh,uZhFh-u~ZhFh.ulZh"Fh%uZZa} udEjuY} Ef f="`jjh!uoYEEEEEEEEE%EEE=&FYt)EG EEG<jjjjjhh$ EY9 EE aEEEE aEEjhE5E59 EZejh] EhhlO59 EY59 E0Y9 ExzF zF5EH E`E,aI|FEE>tY%EEE EF%EEEEEGEGE@EajuW `kFoFjhoF5kF5$GXHkFoFjhoF5kF5$GXjhh@TjXHH4H0 H=H w H󤾧(H<t FG{ H H H(H<t FG H H !HEG%!H !H=Hjh$H5H5H5$GW!H "H=H=Hk(H<t FG!H"H :"Hw H{ H H H!H@!HH"H!H:"H4H=H54HhL EhHV H jjjjh%HY@"Hjjjjh%HjPh H5@"HX(Hjh@h<Hjj5D"Hh%H5(HX,HtT5H54H5H5 Hh<H5,HoXu'h0H5PHhTH5,HgX=THFILEt3=ERujhDhDjQUjhްDhDj@tFȾ(H>.t[F=ERuj0hx&Hh&Hj0Qj0h'Hh'HjQjh uNQh uPPAQjjhh uQuA=ERuWVQk(H-H0Y^_]WVQk(H.H0Y^_Ajjhh uPuA=ERuWVQk(HF.H0Y^_WVQk(Hx.H0Y^_jjhh uPPuA=ERuWVQk(H.H0Y^_WVQk(H.H0Y^_jjhh uOu;=ERuWVQk(H/H0Y^_LWVQk(H@/H0Y^_3=ERuj0hx&Hh&HjnO j0h'Hh(HjYO juN UEPju PjuPusPEu uPEEU;Ew ECEh uujjuuuuuuxPuuUPu#P`=Go=/HA=7Ht[jhjjjh@h:GNGkFoFjhoF5kF5GPOh:GNjhjjjh@h:GNtYGkFoFjhoF5kF5GNcjhjjjh@hG5NGu==ERujh Gh GjMj,Njh\ Ghy GjqMjN=ERujhEj7hG5GNjhEj7hG5GkNjhE5"DhG5GNN"D;Et==ERujhPGh GjLjMjhlGhGjLjnMa`~NTFSugF8P= E 5P=EF0F4G6P=EF8F1G5G1G1G5G?B3gG/gG+gGj5+gGhuHj5/gGhuHj53gGhuH=)jjhu H+gGjjhuGI;rQjQhu`HY/gGjjhuGsjjhu1H?;rQjQhuHY3gG+gG/gG?3gG1G5Gj5+gGhuGj5/gGhuGj53gGhuG1G{8GC=8GLj h8GhuF8G1G?B3gG/gG+gGj5+gGhu Gj5/gGhuFj53gGhuF1Gǘ8GL=u juF U} '=ER5 E1G,1Gh1GhukFh0GhuYFh0GhuGFh0Ghu5Fh0Ghu#Fh0GhuFh1GhuEh1GhuEh%1GuE5 Ev5GJ1Gh1GhuEhz1GhuEh1GhuEh1GhuEh1GhurEh1Ghu`Eh1GhuNEhn5Ghuu G G.GFGF t5EF t5E5E=E5EFE`5‹E5EhG EhƋEBa ƋE=E!5EFE`5‹E5EhG EhƋEAafыE=E< u0fG/G1.G4.G=:F%E`5‹E5EhG EhƋEAafыE< ufG2F% E`5‹E5EhG EhƋE@AaϋEG5F E`5‹E5EhG EhƋE AafыE< u0fG;F%E`5‹E5EhG EhƋE@afыE< u0fG>fFfEfFfE`5‹E5EhG EhƋE@a ƋE=EA5EF =E tGPAtGRRtGTStGVHtGXDtGZV@tG\6tG^7a`5E=E=EG5E3=E5E3=E5E 3=EERhE! = =EG ,BhE=EBa`=0Ht+=PGc~GPGEWVQhOG Y^_WVQhOG Y^_=PGu.~G1GGGfhOfGfhOfGfhOfGfhOfGGGD=Gt fGIS fGIKPG=PGtLPGGDfGIF1GGGGGG*Gf=GIFuf=GISu aa`0H0HhO~ t~ t~ t ~ ~ t~ ty~ ts~ tm~ tg~ ta~ t[~ tU~ tO~ tI~ tC~ t=~ t7~ !t1~ "t+~ &t%~ 't~ (t~ *t~ +t ~ -te_ hO>u =0HtC7~ t#` /H<t G0Haa ƒ=0Ht 0Ha`-GRhB EhEG< PG|fGfGGGGRh6 EhQGh< ZG|GRh6 Eh[GH< dG|GRhB EhuG(< G|f=GIKu9WVQEGY^_GGGGGf=GISu6WVQE GY^_GGGGGbWVQE8GY^_GGGGGWVQQGE Y^_WVQ[GE Y^_`GD/PGaËBBFRhNFP7;NFEPFETFEVFEXFEZRQ5E5E5E5E5Eh^FR:YZB xF|F^~OFIEF |Fyu5F5FByu5F5FByu5F5FByu5F5FByu5F5FByu5F5FBy u5F5FBky u5F5FBRyu5IJF5ȲFB9yu5̲F5вFB ARܲFZ5ܲF5FB9u B YES 9u B NO RZB hA$?RZAARZARZA$?R,ZAAR'ZAR"{ZAFRQ5FhG EhF8 YZFB2FB6FB:A FRQ5FhG EhFH8 YZFB?FBCFBGxF=xFt|FFOølOEEE/EBE E1EȊ<&uBEE=EuЃE E1EȊ<&uBEE=EuE=E bølOEEE/EBE E2EȊ<&uBEE=EuЃE E1EȊ<&uBEE=EuE=E bà=F E5 EE=GCj hEh54E5hE7 E;r*I E5EE E5EEEjhEh54ET5hEb7 E;rI E5EENEjhEh54E5hE7u E E;v EEE%EE%EEEEvj hEh54E4E; Ew r;ErE EEE EBE EEEEEhyFh54E4j5Eh54Eu4j5Eh54E]4j5Eh54EE4`33P57F53̰P57Fx5,E+F0E KE,EIE5,E;uB;Ft#'FRjh'FjW57F2ZB ;F t&'F Rjh'FjW57F2ZB;Ft&'FRjh'FjW57F2ZB;Ft&'F+Rjh'FjW57Fn2ZfBf;Ft%f'F\Rjh'FjW57F?2ZB$;F$t&'F$Rjh'FjW57F2ZB(;F(t&'F(Rjh'FjW57F1ZfB/f;F/t%f'F/Rjh'FjW57F1ZB2;F2uB6;F6uB:;F:t&'F3Rjh'Fj W57Fv1ZB?;F?uBC;FCuBG;FGt&'FC@Rjh'Fj W57F81Z+F,EO 0Ea`hO;G+=hOt=hO~F<t<G*RhB EheG1 pG|5zFh& EhqG1 tG|fGFT=Gt(1GG+G6G1GGGG1WVQGG&Y^_`GjhEhhEG51G1=Et==ERujhPGh GjR0j0jhlGhGj80j0GjhEhhEG5QGM1GjhEhhEG5G+1=E=ERujhPGh Gj/jb0jhlGhGj/jH01GG+GRhB EhuG/ G|G2WVQG=G&Y^_G`GjhEhhEG51Gh0=Et==ERujhPGh Gj/j/jhlGhGj.j/GjhEhhEG5QG/GjhEhhEG5G/=Et==ERujhPGh Gju.j/jhlGhGj[.j.a`=G$MFTu}=GMirrt G GI|FgGGtK-ƃRhB EPo. F :Ћƃ RhL EPS. gG=gG ua1ElO1E1E=1E u1E1E2(E1E1E1E 1E1E1E=1Eu1E1E1E1EC 1E1E1E=1EuEL5h{PEEEEEfEEE(EE`uP=ERu EE EFEhES/u/E`uPE;EGF<uU} =ERuHhFh#ub,hFh#uP,hFh#u>,hFh#u,,jhhu$,Eh#uv+y EfE3Pjh 5y E+jjf5Eh5y E+f=FFPu=ERuF'2F f=FPFu=ERu F_FPjj u^+,EL} u!5E+hE+j+%} uDEf  =#u'5ED+5E9+hES+jX+} =RFu5Euc*u)S+E+EȡREEg%EPhx EhE* NE5E5iEE5ERPh| EhEb* X5*ERPh| Eh EB* XPh| EhE.* =E0uE = E0u f E  E:= E0u E = E0u f E  E:RE%&E5JEfEjjf5Eh5y E\)hEh#u\)hEh#uJ)j5NEh#u/)j5REh#u) `=NErb%aEȿ0ISjh] EPh0I5 E)jhE5] Eh0I5E)RE-NE뒃=NEtLNE%aEȿ0Ijh] EPh0I5 E7)jhE5] Eh0I5ED)RF5Ei(5 E^(9 EE=ERu/WVQFHEY^_j@hFhFj'|WVQҷFHEY^_j@hhFhFjp'M=NEr\%eEȿ0Ijh] EPh0I5 EG(jhE5] Eh0I5ET(RE-NE뛃=NEtLNE%eEȿ0I蓋jh] EPh0I5 E'jhE5] Eh0I5E'RF5E'5 E ' EE=ERu,WVQFHEY^_j@hFhFjJ&*WVQҷFHEY^_j@hhFhFj&aEL5p{PEEEEEfEEE(EE`uP=ERu EE EEhEb(u E`uPE;EGF<ujj jjjhhE%u\EEEjhE5E5E)&E5aEuE5E[%QPSRVW35!FڊF F5!FڊF Ff5!FڊF-Ff5!FڊF- Ff5!FڊF- Ff5!FڊF- F r  F>؊F- F= F0uW F = F0uG F = F0u7 F = F0u' F =F0uF =F0uF F_^Z[XYQPSRVWf3f35:Fڊ*F )F5:Fڊ*F (Ff5:Fڊ*F-'Ff5:Fڊ*F-&F؊*F-%F=%F0u7%F =&F0u'&F ='F0u'F =(F0u(F %F_^Z[XY0123456789ABCDEF`335tD؊tD܊tDGaUV3u3ɊF< u0,0 HF u^`yFyFyFyFyF 3ɖ30RA uXayFU} d j5Gh-uF"jEffPhuB!jEffPhu(!jEffPhu!jEffPhu jEffPhu jEffPhu jEffPhu jEffPhu jEffPhur jEffPhuX jEffPhu> jEffPhu$ jEffPhu jEffPhujEffPhujEffPhujEffPhujEffPh uj EffPh unj EffPh uTj EffPh u:j EffPh u j EffPhujEffPhuhEhujEffPhuhEhujEffPhuhEhurjEffPhuhhEhuFjEffPh u<j EffPh u"j EffPh uj EffPh uj EffPh uj EffPhujEffPhujEffPhujEffPhulhEhuJjEffPhu@hEhujEffPhuhEhujEffPhujEffPhujEffPhujEffPhu=ER@h)Ghukh8)Gh uYhI)Gh!uGhX)Gh"u5hg)Gh#u#hx)Gh$uh)Gh%uh)Gh&uh)Gh'uh)Gh(uh*Gh)uhF+Guh+Ghuh+Ghuh,Ghuth,Ghubh(,GhuPh:,Ghu>h,Gh u,h,Gh uh,Gh uh,Gh uh-Gh uh%-GhuhB-Ghuh_-Ghuh.Ghuh.Ghuh.Gh*uxh/Ghufh'/Gh+uThD/Gh,uB;h:*Ghu+hc*Gh uht*Gh!uh*Gh"uh*Gh#uh*Gh$uh*Gh%uh*Gh&uh*Gh'uh*Gh(uh&+Gh)uwhh+Gu|h+GhuXh+GhuFhL,Ghu4h^,Ghu"hp,Ghuh,Ghuh|-Gh uh-Gh uh-Gh uh-Gh uh-Gh uh .Ghuh*.GhuhG.Ghunh.Ghu\h.GhuJh.Gh*u8h!/Ghu&h]/Gh+uh|/Gh,u } u/Gju; }  Ef  =jjh-uGhujjhPqEhujjhPPEhujjhP/EhujjhPEhu~jjhPEhu]jjhPEhu<jjhPEhujjhPEhujjhPiEhujjhPHEhujjhP'EhujjhPEhuvjjhPEhuUjjhPEhu4jjhPEhujjhPEhujjhPaEhujjhP@EhujjhPEhujjhPEhunjjhPEjhEhuRE舱hu/jjhPEjhEhuEIhujjhP_EjhEhuE hujjhP EjhEhuE˰h urjjhPEh uQjjhP Eh u0jjhP Eh ujjhP~ Eh ujjhP] EhujjhP< EhujjhPEhujjhPEhujjjhPEhhEhuKhu2jjhPEhhEhuhujjhPiEhhEhuhujjhP1E/Gju=u!hujjhP=u!huYjjhP=u!hu1jjhP=u!hu jjhPxe=u!hujjhPP==u!hujjhP(=u!hujjhP=u!huijjhP=u!huAjjhP=u!hujjhPu=u!hujjhP`M=u!hujjhP8%=u!hujjhP=u!huyjjhP=u!huQjjhP=u!hu)jjhP=u!hujjhPp]= u!h ujjhPH5= u!h ujjhP  = u!h ujjhP= u!h uajjhP= u!h u9jjhP=u!hujjhPm=u!hujjhPXE=u!hujjhP0=uPhujjhPuhuxPhEhu=uPhuBjjhPuhu!PhEhuo=uPhu jjhPZuhu PZ/hEhu==uPhu jjhPuhus PhEhu =u_hu= jjhP u'jhu hu P rhEhu [=u_hu jjhPF u'jhuT hu P7 hEhu =u_huq jjhP u'jhu huA P hEhu =hu jjhPv uchEhuq jhur hEhuP jhuQ hEhu/ jhu0 ftt3?u$ ! u$ 0u$ @u$ <u F`=Gjhjjjh@hG Gu==ERujh Gh Gj+ j jh\ Ghy Gj j =ERujhEhhNG5G# jhEhhnG5G jhE5DhEG5G D;Et==ERujhPGh Gj j" jhlGhGjg j a`=QGjhjjjh@h5G QGu==ERujh Gh Gj j jh\ Ghy Gj j =ERujhEhhNG5QG jhEhhnG5QG jhE5&DhEG5QG &D;Et==ERujhPGh Gjd j jhlGhGjJ j a`=Gjhjjjh@hG Gu==ERujh Gh Gjj jh\ Ghy Gjjx jhE5DhD5G jhE5DhD5G D;Et==ERujhPGh Gjmj jhlGhGjSjaÐ`GhOWVQhOG Y^_uKWVQhOG Y^_u2GGfFf~GfFfG-G@>u#GG~Gf~ >@tWGF G$?GȢG㿭G` a` aFGLF 8GtGG(G:tGG%G㿭G` a` aFG=GtgGF GGG㿭G` a` aFGF GVG:F tGG3G㿭G` a` aFG GF tGG=Gt=GtGG>uKG =G`G@㾭GTGaXGЊG ` GG%G Ċg%GGGaG:GtGG>u_1G5GGE‹EEEGVPG|F tAfGDiGrGG=G tGGMGG?fGFiGlGG=G tGG GGFGG|fFfrGfFftGrGRhB EheGe pG|VRhB EhuGH G|GG.G.G :F E`5‹E5EhG EhƋEafыE< u0fG F%E`5‹E5EhG EhƋEafыE< u0fGFE`5‹E5EhG EhƋEafыE< u0fGF%E`5‹E5EhG EhƋEGafыE< u0fGF% E`5‹E5EhG EhƋEaϋE+GRh6 EhQG ZG|=~Gt"~GRh6 Eh[G dG|WVQ[GE Y^_=G=G`G 2EЊFGfG aD`GDFu#jhE5rGhEG5QGGGGG`GGGTGaG<tGAfG D`GEPu#jhE5rGhEG5QG2G Gt a%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%D%|D%xD%tD%D%lD%hD%dD%`D%\D%XD%TD%PD%LD%HD%DD%@D%&֨$6X6N ҧ§zj\N@4( ֦Ħxp`TH8& ֥ĥxj.<Thx¬جТ^ 0`ȣNأjؤx ګʫth\N8֪ƪ~fZP@2$ ҩ©~hP>&֨$6X6N ҧ§zj\N@4( ֦Ħxp`TH8& ֥ĥxj.<Thx¬جCreateStatusWindowA,ImageList_Add1ImageList_Createcomctl32.dll[SHBrowseForFolderASHGetPathFromIDListAShellExecuteAshell32.dll BeginPaint2CheckDlgButton8ClientToScreenLCreateDialogParamAVCreateWindowExADefWindowProcADestroyWindowDialogBoxParamADispatchMessageADrawMenuBarDrawTextAEnableMenuItemEnableWindowEndDialogEndPaintGetClientRectGetDCGetDlgItemGetDlgItemIntGetDlgItemTextA"GetMessageA?GetSubMenutInvalidateRectIsDlgButtonCheckedKillTimerLoadAcceleratorsALoadBitmapALoadCursorALoadIconALoadMenuAMessageBoxAModifyMenuAMoveWindowPostMessageAPostQuitMessageRegisterClassExAReleaseDCSendDlgItemMessageASendMessageASetCursorPosSetDlgItemIntSetDlgItemTextASetFocus2SetTimer=SetWindowTextAHShowWindow[TranslateAcceleratorA^TranslateMessagejUpdateWindow}wsprintfAuser32.dll#CloseHandle5CreateDirectoryA=CreateFileA>CreateFileMappingAOCreateProcessAVCreateThreadiDeleteFileApDeviceIoControlExitProcessFileTimeToSystemTimeGetCommandLineAGetCurrentDirectoryA GetDiskFreeSpaceExAGetDriveTypeA(GetLastError)GetLocalTime4GetModuleHandleAGetTickCountGetTimeFormatAGetUserDefaultLangIDGetVersionExAGetWindowsDirectoryAGlobalAllocGlobalFreeMapViewOfFile MulDiv=ReadFilevSetCurrentDirectoryASetFilePointerSetLastErrorSetUnhandledExceptionFilterSleepVirtualAllocWriteFilelstrcmpiAlstrcpyAlstrlenAkernel32.dll BitBlt!CreateCompatibleBitmap"CreateCompatibleDC.CreateFontA<CreatePenHDeleteDCKDeleteObjectGetDeviceCapsGetObjectAGetTextMetricsALineToMoveToEx.SelectObject4SetBkColorUSetStretchBltModeYSetTextColoreStretchBltgdi32.dll_CoTaskMemAllocCreateStreamOnHGlobalole32.dll(OleLoadPictureoleaut32.dll GetOpenFileNameAcomdlg32.dll\HttpOpenRequestA`HttpSendRequestArInternetCloseHandlewInternetConnectAInternetOpenAInternetReadFilewininet.dll`CoTaskMemFreeFILTR WRIT_CLONFIND_UfFINDSFINDKFINDCFND_WRITITOGVIEWEXTRACTSNITOGWDPFVD_DISK -. /.I/O error. Error reading xxxxxxxxxxxxx 12345 Problem with Internet , ! FomsoftPhotoRecovery.bin Fomsoft . , - fomin@antivirus.ru. When attempting to transfer data, there was a fatal problem! Transfer the file FomsoftPhotoRecovery.bin to the Fomsoft lab in another way. For example, from another computer by e-mail fomin@antivirus.ru. Fomsoft Response from server Fomsoft FomsoftUnFormatNTFS_Error.txt DzFCE MFT. Fomsoft. ! The MFT table is too long. Report the situation to Fomsoft.Fatal situation! 5SYSTEM ERROR CODE 5 - - " ". , - -, , - . The program is terminated due to a system error - "Access denied". This may be with an operating system setting that prevents programs from direct write operations bypassing the operating system's I/O procedures. Or install appropriate security software, such as antivirus. THE WRITE OPERATION FAILED - c ..... . , - - . The program is terminated due to a system error with the code ..... . This can be caused by a disk malfunction or an operating system setting that prevents direct write operations from bypassing the operating system's I/O subsystem. X:Disk X: (MFT)CLEANING MASTER FILE TABLE (MFT) CLEANING FREE SPACE :Processed::Left: To stop immediately RELIABLE, CLEAN DISK FREE SPACEAPPLY DISABLE WRITING TO THE SELECTED DISKENABLE WRITING TO THE SELECTED DISKAPPLY TYPE SERIAL NUMBER CAPACITY RECORDING \\.\PhysicalDrive012345678 40000. w FomsoftPhotoRestore, Fomsoft. , . .The number of found files exceeds 40,000. This exceeds the technical capabilities of the technology of restoring digital photo files with the help of a special program FomsoftPhotoRestore, manufactured in the Fomsoft Laboratory. It is necessary to reduce the number of selected photos, or order a licensed copy of this program.TOO LARGE NUMBER OF RESTORED FILES. , ! . fomsoftDiskAnalyzer.txt Fomsoft . , - fomin@antivirus.ru. The problem with the InternetWhen attempting to transfer data, there was a fatal problem! This can be caused by using an older version of the operating system. Transfer the file fomsoftDiskAnalyzer.txt to Fomsoft lab in another way. For example, by e-mail - fomin@antivirus.ru Response from server Fomsoft , ! Fomsoft fomin@antivirus.ru Skype - fomsoft-cz. When attempting to transfer data, there was a fatal problem! To communicate with Fomsoft Lab, use e-mail fomin@antivirus.ru or Skype - fomsoft-cz. Fomsoft Response server Laboratory Fomsoft , ! FomsoftDataRecovery.bin Fomsoft . , - fomin@antivirus.ru When attempting to transfer data, there was a fatal problem! Transfer the file FomsoftDataRecovery.bin to the Fomsoft Lab in another way. For example, by e-mail - fomin@antivirus.ru MFT SET MFT CHAIN PARAMETERS AND DISC FOR RECONSTRUCTION DATA FOR CALCULATION OF VIRTUAL DISC PARAMETERSLBA LBA elements of file structures for import The boot sector is broken or its eopiyaeTo apply . NTFS. "" NTFS. FomsoftDiakAnalyzerMini.txt NTFS . Error setting the boot sector address. The specified sector is not an NTFS boot sector. Use the "Diagnostics" menu and scan the disk for the presence of NTFS file structures. In the resulting diagnostic file FomsoftDiakAnalyzerMini.txt, find the addresses of the NTFS boot sectors or their copies at end of the section. MFT. $MFT. "" NTFS. FomsoftDiakAnalyzerMini.txt - , MFT .Error specify the address of the MFT. The specified sector does not contain the $MFT file entry. Use the "Diagnostics" menu and scan the disk for NTFS file structures. In the resulting file FomsoftDiakAnalyzerMini.txt find the appropriate address for the file record that describes the beginning of the MFT table or its copy. FILE Record. . "" - NTFS. : 1. FomsoftDiskAnalyzerDEF.txt $AttrDef. 2. FomsoftDiskAnalyzerUSER.txt MFT.Error specify the address of a file record FILE Record. The specified sector does not contain a suitable file entry. Use the "Diagnostics" menu and scan the disk for NTFS file structures. Then try two options: 1. The resulting file FomsoftDiskAnalyzerDEF.txt find any address file entries in $AttrDef. 2. View FomsoftDiakAnalyzerUSER.txt and find the file address records a non-fragmented file from the first fragment of the MFT table. MFT. - MFT. FomsoftDiakAnalyzerSTRING.txt . - Fomsoft. The program was unable to find a chain of MFT fragments.According to the presented data, the program could not find the current chain of MFT fragments. Use the data in the FomsoftDiakAnalyzerSTRING file.txt and form the parameters of this chain manually. Or ask for free assistance in the laboratory Fomsoft. MFT Start MFT or its copyeTo apply MFTFile record file from the first MFT frvgmentaeTo apply Source physical disk TYPE SERIAL NUMBER CAPACITY PARAMETERS OF VIRTUAL DISC The beginning of the virtual disk eTo apply Cluster size in sectorseTo apply ADDRESS OF FRAGMENTS OF THE MAIN FILE TABLE OF THE VIRTUAL DISK LBA LBA LBA LBA LBA starting LBA ending LBA starting LBA ending RUN RECONSTRUCTION 12345678901234567899 ? There is no serial number disc on the computer 12345678901234567899 You can only view the structure and content of the reconstructed directory tree. CONTINUE TO VIEW?The problem disk is not found ., , , . The marked file is extracted.The file marked with the right button is written to the folder where the program was started. 123| 12345678901  |LBA $AttrDef WINRAR WINRAR! c - : - http://www.rarlab.com/download.htm. Fomsoft - fomin@antivirus.ru : FomsoftDiskAnalyzerDEF.txt FomsoftDiskAnalyzerERROR.txt FomsoftDiskAnalyzerMBR.bin FomsoftDiskAnalyzerMINI.txt FomsoftDiskAnalyzerUSER.txt FomsoftDiskAnalyzerDISKI.txt FomsoftDiskAnalyzerSTRING.txt ON YOUR COMPUTER NOT FOUND WINRAR!The program was unable to find on Your PC the WINRAR!. You can download and install this app for free from the official website: - http://www.rarlab.com/download.htm. Or to send to the laboratory Fomsoft email - fomin@antivirus.ru the following diagnostic files: FomsoftDiskAnalyzerDEF.txt FomsoftDiskAnalyzerERROR.txt FomsoftDiskAnalyzerMBR.bin FomsoftDiskAnalyzerMINI.txt FomsoftDiskAnalyzerUSER.txt FomsoftDiskAnalyzerDISKI.txt FomsoftDiskAnalyzerSTRING.txt EXCEEDING THE ALLOWABLE FILE SIZE Fomsoft 9 . FomsoftDiskAnalyzer.rar fomin@antivirus.ru, - . Fomsoft. The program cannot transfer to the laboratory Fomsoft file is more than 9 MB. Therefore, the FomsoftDiskAnalyzer.rar must be divided into several parts and send them to the postal address fomin@antivirus.ru or change the filtering settings selecting custom files. Coordinate in the laboratory Fomsoft. FomsoftDataRecoverySAVE.bin . , .File FomsoftDataRecoverySAVE.bin was not found.The program could not find the file containing the result of the previous reconstruction in the current directory. fomin@antivirus.ru " " . , , , , - "@".Field "Your name is blank or contains invalid data. is Allowed only digits, Latin or Russian let- ters, symbols point, minus, underline, or "@". .Data entry error. "E-mail" , . The field "E-mail" is blank, contains erroneous data or has the wrong format. , .The problem description field is blank, or contains invalid characters. E-mail : 1. FomsoftDiskAnalyzerDEF.txt $AttrDef, . , {}.2. FomsoftDiskAnalyzerSTRING.txt (MFT). 3. FomsoftDiskAnalyzerMAXI.txt. FomsoftDiskAnalyzerMINI.txt FomsoftDiskAnalyzerUSER.txt . 4. FomsoftDiskAnalyzerDISKI.txt . 5. FomsoftDiskAnalyzerERROR.txt . 6. FomsoftDiskAnalyzerMBR.bin . FOMSOFT ( 500 ):SCANNING OF THE SPECIFIC SITE OF THE DISC PLEDGEDCLOSE A WINDOWYour nameE-mailDiagnostic files with information about internal structures of file systems are created: 1. FomsoftDiskAnalyzerDEF.txt contains the addresses of $AttrDef system files, one entry per logical partition. Using the address of this entry, the program can reconstruct the entire directory tree of the corresponding logical disk {partition}. 2. The FomsoftDiskAnalyzerSTRING.txt file contains chains of fragments of the Main File Table (MFT) records.3. FomsoftDiskAnalyzerMAXI.txt, FomsoftDiskAnalyzerMINI.txt FomsoftDiskAnalyzerUSER.txt have the same structure and differ in the composition of file structure types. 4. File FomsoftDiskAnalyzerDISKI.txt contains a list of physical disks and logical partitions located on them. 5. File FomsoftDiskAnalyzerERROR.txt is the addresses of bad sectors and codes of system errors in their reading.6. The file FomsoftDiskAnalyzerMBR.bin contains the data of the zero track of problem disk.REQUEST FOR CONSULTINGSEND A REQUEST FOR A FREE CONSULTATION TO FOMSOFT.Brief description of the problem (up to 500 characters):http://www.antivirus.ru/FomsoftDataRecovery.htmlhttp://www.antivirus.ru/Ksp.html#M_04http://www.antivirus.ru/Okno7.htmlhttp://www.antivirus.ru/chema.htmlhttp://www.antivirus.ru/chemaEng.htmlhttp://www.antivirus.ru/Okno5_SUP.htmlhttp://www.antivirus.ru/Okno5_SUPEng.htmlhttp://www.antivirus.ru/Ksp.htmlhttp://www.antivirus.ru/KspEng.htmlcompmgmt.mscVP_GPTVPSECTORPASSZZDDDV_BOOTV_MFTVDVIRTV_FRV_DISKL_SCR_SCHD_OFFFomsoftIND_WRITVNMFTVNMFTVRILTRFILTRFILTVAILTRPROSWAITWAITPWAITRLICENZSETPARORDERHELPVDNSCANDD1DDPLICINFOEndAnaliz - License - - Program folder - - FreeWare - Fomsoft Data Recovery - . Fomsoft Data Recovery - multi-functional program for data recovery and disk diagnostics.E ....... 123456789012 . All sectors 12345678 12345678901234567890 12345678 . The media type is not defined allowed WRITING ENABLED WRITING LOCKED WRITING DISABLED%2u%3u%4u%5u%9d%9u%10u%u%11u%13u%7u%1u%6d%-.7li%-.4li%-.3li%-.2li%7d%5d%02d%4H I\\.\H:0 \\.\PhysicalDrive0\\.\PhysicalDrive0\\.\PhysicalDrive000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000An invalid version of the operating systemThe program works only on Windows XP/Vista/7Menu1Courier New2J , WAIT until end of the left Until the end of the left ??:??:?? , . . This error can be caused by the fact that the disk is locked for writing by another application. Close this application. ! , . < >. THIS DISK IS WRITE-PROTECTED!To perform write operations to the disk, it must have a permission entries. It can be done from the menu . {20  @Bd< Fonsoft Data Recovery V-8.02 fomin@antivirus.ru WhatsApp +420 603 905 917 Copyright 2017-20 Y FominXR . . . , .You do not have sufficient access rights.The functioning of this program is possible only if You have access rights to the system administrator. In the moment, You have such rights no. Log in with administrator privileges, or ask for help to the system programmer. . . . , < >. , , - <> : < >.The program is not enough access rights.For the functioning of the programme it needs access rights to the system administrator. At the present moment it has such rights no. The program can be run from Windows Explorer by right- clicking on the name of the program and in the menu that opens, select the . These rights can be set by default, it is necessary to log in to the system with administrator privileges, select the conductor of the properties of this programme and in the check the box: .?  PHYSICAL DISK x Cylinder Head Sector LBA Size of sector 512 PHYSICAL DISK x Cylinder Head Sector LBA Size of sector . x LBA 512 LOGICAL DISK File system Sector Cluster Sector in cluster | LOGICAL DRIVE File system Sector Cluster Sector in cluster . VIRTUAL DISK VD? File system Sector Cluster Sector in cluster #FMT VIRTUAL DISK VD? File system Sector Cluster Sector in cluster #FMT VD? . . #FMT 0 1 2 3 4 5 6 7 8 9 A B C D E F Character view cp1251 NAVIGATION: : NAVIGATION: ADJUSTMENT ON View Hex/Sym Cancel Save F12 FORM OF PRESENTATION: Hex F2 FILE Record F3 DIR FAT F4 Table FAT F5 BOOT FAT F6 Table partitioning F7 BOOT NTFS F8 FORM OF PRESENTATION: Hex F2 FILE Record F3 DIR FAT F4 Table FAT F5 BOOT FAT F6 Table partitioning F7 BOOT NTFS F8 : Hex F2 FILE Record F3 FAT F4 FAT F5 . . FAT F6 F7 . . NTFS F8 CODING: DOS-866 Alt+D Windows-1251 Alt+W Unicode Alt+U 000 010 020 030 040 050 060 070 080 090 0A0 0B0 0C0 0D0 0E0 0F0 100 110 120 130 140 150 160 170 180 190 1A0 1B0 1C0 1D0 1E0 1F0cp1251 cp866.. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. .. ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ ........ Z................................ !"#$%&.()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~.................................... !"#$%&'()*.,../0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~.................................................................W 0123456789=-.\ )!"$%^?*(+_,/ 0123456789abcdefghijklmnopqrstuvwxyz;=,-./`[\]' )!@#$%^&*(ABCDEFGHIJKLMNOPQRSTUVWXYZ:+<_>?~{|}"0123456789ABCDEF Partit. Partit. Flag Begin. section Edn of section Starting All number type download Head Cyl. Sec. . . . sector sectors 1 2 3 4 Partit. Partit. Flag Begin. section Edn of section Starting All number type download Head Cyl. Sec. . . . sector sectors 1 2 3 4 . . . . . . 1 2 3 4 Recovery partition Basic data partition Microsoft Microsoft reserved partition Extensible Firmware Interface EFI Header EFI PART Address Name of section MyLBA Alternate LBA Beginning Ending LBA 1 1----------------------------------------------------------------------* LBA 2-1 2----------------------------------------------------------------------* LBA 2-2 3----------------------------------------------------------------------* LBA 2-3 4----------------------------------------------------------------------* LBA 2-4 5----------------------------------------------------------------------* LBA 3-1 6----------------------------------------------------------------------* LBA 3-2 7----------------------------------------------------------------------* LBA 3-3 8----------------------------------------------------------------------* LBA 3-4 9----------------------------------------------------------------------*= Address Name of section MyLBA Alternate LBA Beginning Ending LBA 1 1----------------------------------------------------------------------* LBA 2-1 2----------------------------------------------------------------------* LBA 2-2 3----------------------------------------------------------------------* LBA 2-3 4----------------------------------------------------------------------* LBA 2-4 5----------------------------------------------------------------------* LBA 3-1 6----------------------------------------------------------------------* LBA 3-2 7----------------------------------------------------------------------* LBA 3-3 8----------------------------------------------------------------------* LBA 3-4 9----------------------------------------------------------------------* LBA LBA LBA 1 1----------------------------------------------------------------------* LBA 2-1 2----------------------------------------------------------------------* LBA 2-2 3----------------------------------------------------------------------* LBA 2-3 4----------------------------------------------------------------------* LBA 2-4 5----------------------------------------------------------------------* LBA 3-1 6----------------------------------------------------------------------* LBA 3-2 7----------------------------------------------------------------------* LBA 3-3 8----------------------------------------------------------------------* LBA 3-4 9----------------------------------------------------------------------* LBA = q . . 1 x y 2 x y 3 x y 4 x y 5 x y 6 x y 7 x y 8 x y LBA - 234 123 123 . . BACKUP OF THE PARTITION TABLE LBA - 234 123 123 Purpose of the section Start partit. End Partition ........ YES 123 1023 63 123 1023 63 12345678901 12345678901 EXTENDx YES 123 1023 63 123 1023 63 12345678901 12345678901 NTFS YES 123 1023 63 123 1023 63 12345678901 12345678901 NTFS YES 123 1023 63 123 1023 63 12345678901 12345678901 ........ YES 123 1023 63 123 1023 63 0 000 000 000 0 000 000 000 EXTENDx YES 123 1023 63 123 1023 63 0 000 000 000 0 000 000 000 NTFS YES 123 1023 63 123 1023 63 0 000 000 000 0 000 000 000 NTFS YES 123 1023 63 123 1023 63 0 000 000 000 0 000 000 000 () 1234567890123 1234567890123 1234567890123 1234567890123 1234567890123 1234567890123 FR 8 + () 1234567890123 1234567890123 1234567890123 1234567890123 1234567890123 1234567890123 FR 8 Calculated addresses of file data area fragments File system object Minimum Maximum Logical cluster 1234567890123 1234567890123 Logical sector 1234567890123 1234567890123 Physical sector 1234567890123 1234567890123 The cluster size FR 8 Descriptor record MFT Actuality FILE Record That describes Where data is located Form storage on disk Own number Parent directory Creation time Mmodification time Mmodification time MFT The last time reading Attributes in terms DOS Allocated on disk Aactual size Number of fragments Name in the format 8.3 The long name of topical not relevant describes the file describes folder within the FILE Record separately on disk On default ompressed, not encrypt.ompressed and encryptedNot compres., encrypted Descriptor record MFT Actuality FILE Record That describes Where data is located Form storage on disk Own number Parent directory Creation time Mmodification time Mmodification time MFT The last time reading Attributes in terms DOS Allocated on disk Aactual size Number of fragments Name in the format 8.3 The long name of topical not relevant describes the file describes folder within the FILE Record separately on disk On default ompressed, not encrypt.ompressed and encryptedNot compres., encrypted MFT FR FR MFT DOS , FILE Record , , 01 FILE Record 02 FILE Record 03 FILE Record , 1024 04 FILE Record 1024 05 06 10h 07 10h 30h 08 1800 09 80h 10 , = 011 >812 >8 13 14 30h 500 15 10h 500 Information about fragments of file (Starting cluster number/Number clustersin chain) Beg cluster Length Beg cluster Length Beg cluster Length Beg cluster Length Information about fragments of file (Starting cluster number/Number clustersin chain) Beg cluster Length Beg cluster Length Beg cluster Length Beg cluster Length ( / ) . . . . 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 123456789012 1234567 Data resident located inside of the recording FILE Record , FILE Record Data resident located inside of the recording FILE Record 123456789012345678901234567890123456789012345678901234567890123456789012345678901234567 THE NAME PARAMETER CHARACTER HEXADECIMAL OFFSET LENGTH 0 0 3 3 3 8 512 0002 B 11 2 4 04 D 13 1 0 0000 E 14 2 Always zeros 000000 10 16 3 Not used 0000 13 19 2 Descriptor media F8 15 21 1 Not used 0000 16 22 2 Sectors on the head 63 3F00 18 24 2 The number of heads 255 FF00 1A 26 2 Sectors to section 63 3F000000 1C 28 4 Not used 00000000 20 32 4 Configuration 80008000 24 36 4 Number of sectors 123456789012 FF813E0000000000 28 40 8 No. cluster $MFT 786432 FF813E0000000000 30 48 8 No. cluster $MFTMirr 786432 FF813E0000000000 38 56 8 Size Of FILE Record 10 F6000000 40 64 4 Size Of Index Block 2 02000000 44 68 4 Volume serial number FF813E0000000000 48 72 8  0 0 3 . 3 3 8 512 0002 B 11 2 4 04 D 13 1 0 0000 E 14 2 000000 10 16 3 0000 13 19 2 F8 15 21 1 0000 16 22 2 63 3F00 18 24 2 255 FF00 1A 26 2 63 3F000000 1C 28 4 00000000 20 32 4 80008000 24 36 4 123456789012 FF813E0000000000 28 40 8 MFT 786432 FF813E0000000000 30 48 8 MFTMirr 786432 FF813E0000000000 38 56 8 FILE Record 10 F6000000 40 64 4 Index 2 02000000 44 68 4 FF813E0000000000 48 72 8 THE NAME PARAMETER CHARACTER HEXADECIMAL OFFSET LENGTH The team of transit. 0 0 3 Identifier 3 3 8 The size of sector 512 0002 B 11 2 Sectors per cluster 4 04 D 13 1 Reserve sectors 0 0000 E 14 2 Always zeros 000000 10 16 3 Not used 0000 13 19 2 Descriptor media F8 15 21 1 Not used 0000 16 22 2 Sectors on the head 63 3F00 18 24 2 The number of heads 255 FF00 1A 26 2 Sectors to section 63 3F000000 1C 28 4 Not used 00000000 20 32 4 Configuration 80008000 24 36 4 Number of sectors 123456789012 FF813E0000000000 28 40 8 No. cluster MFT 786432 FF813E0000000000 30 48 8 No. cluster MFTMirr 786432 FF813E0000000000 38 56 8 Size Of FILE Record 10 F6000000 40 64 4 Size Of Index Block 2 02000000 44 68 4 Volume serial number FF813E0000000000 48 72 8 THE NAME PARAMETER CHARACTER HEXADECIMAL OFFSET LENGTH The team of transit. 123456 0 0 3 Identifier NTFS.... 4E54465320202020 3 3 8 The size of sector 512 0002 B 11 2 Sectors per cluster 4 04 D 13 1 Reserve sectors 0 0000 E 14 2 The number of FAT . .. 10 16 1 Number of elements ROOT ..... .... 11 17 2 Sectors on small disk ..... .... 13 19 2 Descriptor media F8 15 21 1 Size of FAT for FAT16 ..... .... 16 22 2 Sectors on the head 63 3F00 18 24 2 The number of heads 255 FF00 1A 26 2 Sectors to section 63 3F000000 1C 28 4 Sectors on the disk 123456789012 00000000 20 32 4 Size of FAT to FAT32 123456789012 80008000 24 36 4 Cluster ROOT FAT32 123456789012 00000000 2C 44 4 Additional information 12345 0000 30 48 2 Copy of the BOOT 12345 0000 32 50 2 ID FAT 12345678 1234567890123456 36 54 8 ID FAT32 12345678 1234567890123456 52 82 8 Volume Serial Number of FAT32 12345678 43 67 4 Volume Serial Number of FAT16 12345678 27 39 4 K THE NAME PARAMETER CHARACTER HEXADECIMAL OFFSET LENGTH The team of transit. 123456 0 0 3 Identifier NTFS.... 4E54465320202020 3 3 8 The size of sector 512 0002 B 11 2 Sectors per cluster 4 04 D 13 1 Reserve sectors 0 0000 E 14 2 The number of FAT . .. 10 16 1 Number of elements ROOT ..... .... 11 17 2 Sectors on small disk ..... .... 13 19 2 Descriptor media F8 15 21 1 Size of FAT for FAT16 ..... .... 16 22 2 Sectors on the head 63 3F00 18 24 2 The number of heads 255 FF00 1A 26 2 Sectors to section 63 3F000000 1C 28 4 Sectors on the disk 123456789012 00000000 20 32 4 Size of FAT to FAT32 123456789012 80008000 24 36 4 Cluster ROOT FAT32 123456789012 00000000 2C 44 4 Additional information 12345 0000 30 48 2 Copy of the BOOT 12345 0000 32 50 2 ID FAT 12345678 1234567890123456 36 54 8 ID FAT32 12345678 1234567890123456 52 82 8 Volume Serial Number of FAT32 12345678 43 67 4 Volume Serial Number of FAT16 12345678 27 39 4 123456 0 0 3 NTFS.... 4E54465320202020 3 3 8 512 0002 B 11 2 4 04 D 13 1 0 0000 E 14 2 . FAT . .. 10 16 1 ROOT ..... .... 11 17 2 . ..... .... 13 19 2 F8 15 21 1 FAT FAT16 ..... .... 16 22 2 63 3F00 18 24 2 255 FF00 1A 26 2 63 3F000000 1C 28 4 123456789012 00000000 20 32 4 FAT FAT32 123456789012 80008000 24 36 4 .. 123456789012 00000000 2C 44 4 FSINFO 12345 0000 30 48 2 BOOT 12345 0000 32 50 2 FAT 12345678 1234567890123456 36 54 8 FAT32 12345678 1234567890123456 52 82 8 FAT32 12345678 43 67 4 FAT16 12345678 27 39 4 ........ ... . . ... ... ... ............ ............ ............ .... .... ...... ................ .... .. ................ ................ ................ ........ ........ ................ ........ ... . . ... ... ... ........ .... 12345678 12345678 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 12345 0 1 2 3 4 5 6 7 8 9 A B C D E F 00 10 20 30 40 50 60 70 80 90 A0 B0 C0 D0 E0 F0 0 1 2 3 4 5 6 7 8 9 A B C D E F 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901 1 3 5 7 9 B D F 00 10 20 30 40 50 60 70 80 90 A0 B0 C0 D0 E0 F0 1 3 5 7 9 B D F The Name Extension Type Length Date Time Cluster A R S H D V 6 7 b A R S H D V 6 7 The Name Extension Type Length Date Time Cluster A R S H D V 6 7 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - 12345678 123 1234567890123 14.03.2009 12:36 123456789012 - - - - D - - - & explorer.exe Far.exe calc.exe msconfig.exeshutdown -t 0 -r -fshutdown -t 0 -s -f12345678901234567890123456789012345678901234567890123456789012345678'@B - - ( ) / LBA THE TYPE OF CHANNEL AND DISK PARTITIONING METHOD FILE SYSTEM LOGICAL DRIVES OR PARTITIONS Number - Capacity - Serial numer (Flash ID) Logical drive letter or number is partition / Capacity The model name of the hard drive LBA of the beginning of a logical drive or partition on the hard drive -- - FAT-32 NTFS FAT-16 FAT-16 FAT-16 FAT-16 HD3 1234.123 12345678901234567890 12345678 C: 1234,123 D; 1234,123 E: 1234,123 F: 1234,123 G: 1234,123 H:1234,123 WDC WD2500SB-01KBA0 63 234436545 40965813 123456 12345678 12345678 FAT-32 NTFS FAT-16 FAT-16 FAT-16 FAT-16 HD4 1234.123 12345678901234567890 12345678 C: 1234,123 D; 1234,123 E: 1234,123 F: 1234,123 G: 1234,123 H:1234,123 WDC WD2500SB-01KBA0 63 234436545 40965813 123456 12345678 12345678 FAT-32 NTFS FAT-16 FAT-16 FAT-16 FAT-16 HD5 1234.123 12345678901234567890 12345678 C: 1234,123 D; 1234,123 E: 1234,123 F: 1234,123 G: 1234,123 H:1234,123 WDC WD2500SB-01KBA0 63 234436545 40965813 123456 12345678 12345678 FAT-32 NTFS FAT-16 FAT-16 FAT-16 FAT-16 HD6 1234.123 12345678901234567890 12345678 C: 1234,123 D; 1234,123 E: 1234,123 F: 1234,123 G: 1234,123 H:1234,123 WDC WD2500SB-01KBA0 63 234436545 40965813 123456 12345678 12345678 H z         fomin@antivirus.ru !Possible fatal error! HDX . !When working with the disk HD X there was a problem. Further work program cannot be! , LBA 62. . ! , , OK. To allow write operations, the program uses the LBA 62 sector. In most cases, this sector is not used by the operating system and contains zeros. However, sometimes it is still used and can contain useful information! If You think that writing to this sector on the disk is X ac- ceptable, confirm this by pressing OK. , NTFS FAT32. !The specified disk is either missing, or its file system is different from NTFS or FAT32. THE DISC IS NOT CORRECTLY SPECIFIED!I|F_E ************** 0 . LFN C: 1234,123 D; 1234,123 E: 1234,123 F: 1234,123 G: 1234,123 H:1234,123 H: 1234,12312345678901 12345678901 12345678901 12345678901 12345678901 12345678901 12345678901C: 1234,123 D; 1234,123 E: 1234,123 F: 1234,123 G: 1234,123 H:1234,123 H: 1234,123 Internal channel SATA/PATA External hard drive Flash memory card or flash disk The port not recognized External port SATA External port SUNPLUS External port IO_DATA External port LOGITEC External port JMICRON External port CYPRESS USB HD0 1234.123 12345678901234567890 1234567812345678901234567890123456789012345678901234,123 NTFS?:PP xxxxxxxx KWork ? Replace the file on the new?A file with this name already sitJPG files*.jpgAll files*.*Dir files*.dirAll files*.* , .Specify the source file containing the directory tree. .Specify source file to be written to disk. .Specify the file where to write the data from the disk.l?? ? ! $MFT ATTRIBUTE_LIST $20. MFT, .By browsing the directory tree of the disc is impossible!In the main table entries $MFT found attribute ATTRIBUTE_LIST $20. This is rarely met by a variety of formation of the table MFT, in this version of the program processing such structures has not been implemented.FomsoftDataRecoveryLOG.txtFomsoftDataRecoverySAVE.binEPhys.sector|Ext| Size | Date creation | Date adjustment | Own ID |ID parent|F|D|LBA beg.dat|Fr.| Name ..|| | | |. | |||LBA .|.| 0 . Fomsoft . - , . ? Item - 123456789 %lu 1 20123456789 X:ZZZZ Fomsoft Data Recovery V-7.02 :.......????-??-?? ??:?? .NT/XP X: HDx LBA .....12345678901 ..12345678901 HDD...12345678901234567890 ...... - , - , ...... . ..... - , - , ...... . : ........ .......... ............... .......... .............. .......... 00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 SEARCH AND FILTERING OF FILES MTF READING THE TABLE OF MTF IN MEMORY MTF EXTRACTION OF INFORMATION FROM MTF CREATE A FILE DIRECTORY TREE 7F . . . . .FCONSTRUCTION OF A DIRECTORY TREE.INSTALLATION OF THE FEATURE SELECTION.REMOVING THE FEATURE SELECTION.THE FORMATION OF THE REQUEST FILE.RESTORE MARKED FILES. . You do not select any file to restore.REQUEST FOR THE RESTORATION WAS NOT CREATEDERRORFomsoftDiskDoctor.zap%04d.%02d.%02d %02d:%02d VDiskInsRestor.RSTF .Selecting a folder for recording dataThe selected folder must not be located on the logical drives locatedon the source disk. ! , , . . - , USB . INCORRECTLY SPECIFIED DISK FOR RECORDING DATA!You select a folder, which is located on a physical disk, where are extracted data. Select a folder on another physical disk. It can be AC, flash or USB removable disk. ! , , . . - USB . INCORRECTLY SPECIFIED DISK FOR RECORDING DATA!You select a folder, which is located on the logical disk, where are extracted data. Select a folder on another logical drive. It can be AC, flash or USB removable disk. , , : , , : Extract files completed Marked files, with directory, stored in folder: . . 1 64 .. , . ? This function is intended to check the POSSIBILITY of the program to recover files in the current situation of data loss. This will restore non-fragmented files between one and 64K bytes in length. To restore files of a different length, right- click on their name. DO A TEST RESTORE FILES? CONTROL OF THE LEVEL OF POSSIBLE RECOVERY 4. .THE RESTRICTION OF FUNCTIONALITYImplementation of this feature for drives with a sector size 4. in this version of the program is not provided. . , , . , , . !The program does not find the key disk. If you forget to connect your computer to a disk,for which it was issued a license, plug it in and run the program again.Violation of the license!.4EP]`G%KF , ! WE CAN HELP YOU, WHEREVER YOU ARE! wYFFomsoft Data Recovery, , - , - , , USB . -, , , - , . Fomsoft Data Recovery , - , , , , . , , , , . , - Fomsoft , . , . 90% , , . , . , , - . MFT, - , . , . - 64- , . , . Fomsoft - . 1 10 0 . 600 . . . RFFomsoft Data Recovery is a multi-functional tool for data recovery, analyzing the state of file structures and finding the location of data on disk devices, internal and external disks, as well as USB flash drives. It is intended for both non-professional users who do not know how to organize the functioning of file systems, and information recovery professionals, allowing them to find and explore the contents of individual file structures in a convenient and natural interpretation, rather than in binary and hexadecimal form. Using the Fomsoft Data Recovery program in most cases of data loss allows users and main- tenance personnel of computers that do not know the wisdom of data recovery to independently cope with the problems that arise, which are not related to the fatal failure of the problematic media that requires physical repair in a laboratory equipped with special equipment for the appropriate repair. If a user has problems and does not know what to do in this situation, they can ask for free advice directly from the program.in many cases, this is enough to solve the problem. In addition, any user can use the service of the Fomsoft Laboratory for remote data recovery by launching a remote access session to the desktop of their computer from the program. This service is paid only if the problem is successfully solved, and its cost is the lowest in the world..In actual fact, the carrier is actually taken hostage. Data from it is written off, and the user is presented with the amount, repeatedly exceeding the roughly stated, because this case is very complicated, it happens! If it is too expensive for him, he is offered to find another repairman and return the carrier, pretreated in such a way that nothing is already on it or by putting deliberately defective parts. At the same time, the user is told that he has such a difficult case that only such unique specialists as they can solve his problem! The user, turning to other specialists, is convinced that his case is indeed very complicated and if the data is very important to him, he grants the amount claimed with grati tude without suspecting that no experts, not just scoundrels and swindlers, have deceived him! The program comes in two versions, Free and Licensed. In the free version, there is only the function of verification data recovery, while only unfragmented files with a length of one to 64 KB are restored. The licensed version of the program performs a full recovery of all found files from any logical drives located on licensed physical devices. You can order a licensed version of the program in advance by selecting and paying for them. The list of serial numbers of licensed disks is stored on the Fomsoft Lab server and is dynamically updated by the command of the owner of the License. The cost of the License depends on the number of licensed media from 1 to 10 and is in the range of 0 EUR up to 9 EUR for one licensed drive. Warning - the Licensed version of this program only works if you have access to the Internet. Disks Available physical and logical disks Dividing physical disks into logical partitions Disable logical drives from system ()Connect disabled partition Deleting data without being able to restore it Search for location of information on disk Cloning problematic disks to a working device Restart computer Turn off computerData Recovery On the logical drive NTFSFrom a formatted NTFS drive :Create a virtual disk by data: Writing sectors from disk to file Download the result of reconstruction- MFT- MFT disk boot sector- $MFT- start addresses of the $MFT file table- FILE Record- file record file FILE Record- - arbitrary parameter setting Recover digital photo filesDiagnostics Disk and logical file system structures Zeroing all sectors of a physical disk Zeroing unallocated sectors of a logical driveView Viewing logical structures Alt+PPhysical sector Alt+P Alt+SLogical sector Alt+S Alt+CLogical cluster Alt+C MFT Alt+NNumber record MFT Alt+N Ctr+SSector partition Ctr+S Ctr+CCluster partition Ctr+C GPT Alt+GCopy of table GPT Alt+G Moving in the vector space Format the interpretation of the displayed data Configuring navigation options HomeIn the beginning of the disk Home EndIn the end of the disk End UPForward sector Up DownBack on the sector Down Arrow rightForward by a group of sectors Arrow right Arrow leftAgo group of sectors Arrow left PageUp Back on the block of sectors PageUp PageDown Ahead of the block secto PageDown HEX F2HEX format F2CloningClearingSearch Remote assistance Starting a remote computer assistance sessionFomsoft - Fomsoft - technology for computer assistance services FomsoftFree analysis of diagnostic results in Fomsoft Fomsoft Data recoveryFull description of the Fomsoft Data recovery program Free consultation About a program . Send email to the support teamLicense Current License status Ordering a licensed versionxxxxxxxxxxxxxxxx\\.\PhysicalDrive000000000000000000000000000ʚ;.... FFILEI|Ftracking.log NTFSFAT-32FAT-16 FILE RecordIt is not a FILE Record This is the folder Memory-residente file Outdated file system $FMTNo file $FMT FILE Record The FILE Record is correct FILE Record The FILE Record is not correct , FILE RecordOutdated FS, there is no own number of FILE Record MFT Calculated the address of beginning of MFT in cluster sectors FILE Record This record FILE Record is about memory resident file FILE Record This record FILE Record is about folder MFTThe current site is missing the beginning of the table MFT (BOOT) Billing address of the beginning of the boot sector (BOOT) ComplianceMFTFAT-32FAT-16 $MFTThere is no $MFTN ROOT FOLDER0 2017.01.01 00:002017.01.01 00:000Lost folder 123456789 0...2017.01.01 00:002017.01.01 00:00Lost folder 123456789 FATFAT_CopyROOTDATABOOTMFTMFTMirrBOOT_Copy NTFS Flash Hard %04d.%02d.%02d %02d:%-2liFAT DOS-16 EXTEND FAT-16 NTFS FAT32 FAT32x FAT16x EXTNDx GPT xxh TYPE SERIAL NUMBER CAPACITY RECORDING --Address in the format of the cylinder-head-sectorCylinderHeadSector LBAAddress of LBA format # sectorRecordView The parameters of physical disks 1234567890123All sectors 1234567890123 The choice of initial physical sector addresses GPT Reading copy of GPT table from the selected disk Record physical sector of the disk to a fileRecord from a file in the physical sectorPF : Sector of hard disk is written to the fileThe specified area of the hard disk is written to the file: : Data is written to the physical diskThe hard disk is written specified area of the File: 0123456789ABCDEF 0123456789ABCDEF ....,,,,,,,,,,,,,,,q xxx yyy zzzqQxxXyyY zzZ? ??? ??? ???12345678901ʚ;%09u%04u%04u SOURCE LOGICAL DISK :Letter of logical drive: Initial value Display the numberBOOTMFTMFTMirrBOOT_CopyFATFAT_CopyROOTDATA Initial value Display the number ()Source logical partition on HDNumber of the hard diskNumber partition ?: ? Sector ClusterCluster logical drive ?: on HD? ????000000???? ()SECTOR CLUSTERCLUSTER LOGICAL PARTITION . . !Disk with the drive letter identifier on your computer is missing. Enter the correct disk number.THIS LOGICAL DRIVE IS NOT! NTFS Search filter file extensionArchive filesMail filesApplication filesThe expansion of the userFiles graphic formatsMultimedia filesProfessional digitalSearch filter files by the initial characters of the nameDisk with NTFS file systemphotosThe letter logical diskYour extension 1Your extension 2Your extension 3Your extension 4Graphic files (*.gif)Graphic files (*.tif)Graphic files (*.jpg)Video (*.avi)Music (*.mp3)Sound files (*.waw)Photos Nikon (*.nef)Photos Canon (*.cr2)Disable filtering files by extension, to search for allin addition to system filesDisable filtering on the name of file, search for allTo find the actual filesTo search for deleted filesCreate analytical TXT-fileApply The search options are user files and specifying a logical diskANALYSIS OF THE FILE SYSTEMFiles and foldersExistingDeletedFiles found allOne of them selectedFolders (directories)Total file size (MB)Ssize of the selected filesWAIT FOR TERMINATION OPERATIONSProcessing time depends on the amount of data being processed.It may take milliseconds or several minutes.Wait for the end of reconstruction the directory tree. The total time of all processes depends on the number of selected files. With their large number may take a few minutes. . , . . . - . CLEARING DIRECTORY TREE OF DELETED TABLE OF CONTENTS ELEMENTS NAVIGATION OPTIONS Size block of sectors Size of the pie groupSet parametersSelect allRepay allCHECK EXTRACT RESTORE FILES REQUEST LICENSED PROGRAMDeletedExistingFiles found allThe total file size (MB)One of them selected The total file size (MB)Noted for the restoration ofThe total file size (MB)Address of the first physical sectorAddress of the last occupied sectorTo restore any file, right-click on its name, it will be written to the folder where the FomsoftDataRecovery program was launched. The area on disk occupied by data filesSave the tree of directories in the fileAll tree entirelyOnly marked To stop immediately LBA LBA SOURCE DISKThe start address of the trackThe end of the sectionCATALOG FOR RECORDING FILENAME OF RECORDED FILEPARAMETERS OF DISK DEVICESLBA LBA TYPE SERIAL NUMBER CAPACITY RECORDING Selecting source disk and the name of the file to writeRECORD .Speed Of KB.LeftReadStopFINAL DRIVEThe start address of the trackCURRENT FOLDERTHE NAME OF THE SOURCE FILEPARAMETERS OF DISK DEVICESCylinderHeadSectorLBA addressBurn to disc, with the beginning of the file, sectorsType disc Capacity Cylinders Max. LBA size sec. RecordSELECTING THE SOURCE FILE OR DISK TO RECORDRECORD . : 1. . 2. , - .ERROR LOW-LEVEL DISK WRITELow-level recording on a disk drive has failed. This may be caused by: 1. Technical malfunction of the device. 2. The result of the work of the means of protection, prohibiting applications low-level record. , .Error search for filesOn the disk is not detected a single file that satisfy the search criteria. EXEDLLINFCPXCPLTLBSRGMUISYSOCXDATROMUCENLSMSCWSCHLPVBSSEPSIGSQLSVETBLTHATRMTSKTSPUNMVXDXMLACMAX BINCAPCHMCHSCHTCMDCNTCOMCPIDBLDEPDEUDRVENGENUESNFRAHXXIECIMEINIITALOGMANMAPMODMSINLDNT OLBPDBPRORAMRATREGRLLRSPSCRCHKEVTDLSJS BAKCATFONTTFXSLMOFMFLSCPMMFSAVSDBSDFTMP_DDWBKSDIOLDGIDDB$$$$ANICURCLICABADMPNFXSDNVBTVPHHKQEULNKJOBPOLMFCMSPBACASP2. 2. Source physical diskTYPE SERIAL NUMBER CAPACITY MFTCOMPLIANCETO RECONSTRUCT THE DIRECTORY TREECALCULATED POSITION OF BEGINNING OF TABLE MFT INITIAL DATA FOR CALCULATION OF1. (BOOT )1. Beginning of a virtual disk (BOOT sector)CALCULATED PARAMETERS OF VIRTUAL DISK3. (BOOT )3. The beginning of the virtual disk (BOOT sector)4. MFT4. The starting address of the MFTModeling the directory tree beginning at address MFT MFTModeling the directory tree from FILE Record FILE Record...LBA MFTCyl.HeadSec.LBA of the boot sectorCALCULATED POSITION OF BEGINNING OF MFT MFT SectorClusterNo MFTRUN RECONSTRUCTIONAPPLY FAT ROOT ROOT $MFTType of file systemCluster size in sectors ofBackup sectorsFAT size in sectorsNumber cluster ROOTNumber elements ROOTCluster number $MFT1. Starting address of the main file MFT3. Beginning of a virtual disk (BOOT sector)4. Cluster size in sectors of the5. Starting cluster of file table MFTLBA MFT LBA of the MFT on the HD1. LBA FILE Record1. LBA FILE Record5. Cluster size in sectors of the6. Diagnostics of stages of calculating parameters of virtual disk3. Beginning of a virtual disk (BOOT sector)5. . . In this version of the program implementation of this function is not provided. It is reserved for future versions of this program.The feature is not available !Error file selectionThis file was carrying win a data directory tree! : 12345678901234567890 Not found desired hard diskNot found hard disk serial number: 12345678901234567890 DirHd-X_Ld-Y.dirDirX12345678901234567890 , . ? A SYSTEM REBOOT IS REQUIRED For the entry into force of the changes made, you must perform a system reset. To reboot now? . GUID Partition Table (GPT) , Windows , . LBA 58, . - . Windows . , - , . ! , , . , This operation consists in changing the first four sectors of the hard disk. They modified standard GUID Partition Table GGPT so that the operating system Windows, the drive remains busyt but unused. A copy of the source sectors recorded at LBA 58, and is used to return the disk layout to the original condition. For the entry into force of this operation will restart the system. This disk for Windows will be untagged. If the disk were failures sector of space which led to the failures and lockups and they won't interfere with the operating system. ATTENTION! Data on that drive will have to restore third party programs such as this. HARD DISK TO BE MADE INVISIBLE Windows Make the disk for Windows is not marked up with LBA 58. - . Windows . , , - . ! , - . , - . , ! , This operation restores the original value of the first four sectors on the hard disk from a previously saved their copies at the following address LBA 58. For the entry into force of this transaction will be rebooted the system. After a reboot this disk for Windows will be delineated. But, if the disk is the failure of the sector of space, they can lead to different problems and hangs. ATTENTION! At the time of the reboot, the system can try to run a scan disk. With this, it prints a warning message, and for some time will wait for the user to press the SPACE key to cancel the scan. Scan disk can lead to irreversible loss of information so it allow IN NO CASE can NOT be! HARD DISK, WHICH MUST BE RETURNED TO THE SYSTEM WindowsMake the disk visible to Windows00000000FosSoftDoctor.reqFomsoftDiskAnalyzer.bin NTFS ....... .. ...... .....12345678901234567890 : -- :  .Now this operation impossibleAt the moment the computer does not have hard disks with this partition. .Incorrect number of hard diskOn the specified hard disk no such partition. . .INCORRECTLY SET TO THE HARD DRIVE.Hard disk with the specified sequence number does not contain disconnected partition. . .Entered a non-existent room partition. NCORRECTLY SET TO PARTITIONMBR OFF MFT LBA MFT $MFT Show the MFT record number Start LBA of the diskMFT record NumberNumber of cluster $MFTThe cluster sizePhysical diskParameters virtual disk / WAIT FOR OPERATION TO COMPLETERecorded MBSpeed KB/SMB LeftCurrent restore fileFolderFileTO STOP IMMEDIATELYOKOK?LBA .|.|| | | | ||.|.| () |...|...| |.........|xxxxxxxxxxxxxxxx|xxxxxxxxxxxxxxxx|.|.........| | ^ROOT FOLDER 2017.11.04 12:000...gggg.mm.dd xx:xxgggg.mm.dd xx:xx. SELECTING A DISC FOR DIAGNOSTICS OF THE SURFACE AND ANALYSIS OF THE FILE STRUCTURES LEADING ON IT MFT SPECIFY the range of sectors analyzed land plotSPECIFY the logical or physical driveSPECIFY the folder for recording file analysisSet up Search BeginningEndingLogical drive letterorPhysical drive numberDegree of details of the information about the failuresTo ignore the chain of recordsthe MFT is less thanDisplay fault information on the screenWrite in the log file only a brief diagnosis ANALYZINGFilter searchFILE Record F3FILE Record F3 FAT F4Table of contents FAT F4 FAT F5FAT table F5 FAT F6FAT boot sector F6 F7Table partitions F7 NTFS F8NTFS boot sector F8 Search by mask from file Search by context from file Search by context from the keyboard Allow to write to the disk Remove write permission to disk Copy a group of sectors to another diskFomsoft Data Recovery analysis logical drive Fomsoft Data Recovery ?: ? -- : Fomsoft Data Recovery analysis physical disk Fomsoft Data Recovery -- : G ... Disk analysis ... completedFomsoftDiskCloningERROR.txtFomsoftDiskCloningLOG.txtFomsoftDiskAnalyzerSTRING.txtFomsoftDiskAnalyzerDEF.txtFomsoftDiskAnalyzerERROR.txtFomsoftDiskAnalyzerMBR.binFomsoftDiskAnalyzerMINI.txtFomsoftDiskAnalyzerMAXI.txtFomsoftDiskAnalyzerUSER.txtFomsoftDiskAnalyzerDISKI.txt?:\Program Files\WinRar\WinRAR.exea FomsoftDiskAnalyzer.rar FomsoftDiskAnalyzerSTRING.txt FomsoftDiskAnalyzerDEF.txt FomsoftDiskAnalyzerERROR.txt FomsoftDiskAnalyzerMBR.bin FomsoftDiskAnalyzerMINI.txt FomsoftDiskAnalyzerUSER.txt FomsoftDiskAnalyzerDISKI.txt FomsoftDiskAnalyzer.rar FomsoftDiskAnalyzer.rar. - WinRAR . . , FomsoftDiskAnalyzerUSER.txt , - fomin@antivirus.ru In the current directory not found the archive file FomsoftDiskAnalyzer.rar. This may be the result of errors functioning of the external application WinRAR or a lack of free space on your disk to locate this file. Eliminate the cause and run the program again. If this is not possible, zip the file FomsoftDiskAnalyzerUSER.txt any other archiver, and send the archive to the email address of the laboratory - fomin@antivirus.ru FATAL ERROR . . FILE CREATION ERROR ANALYSISWhen you create a file analysis emerged fatal error. you May have specified a protected disk records. . - ERROR WRITING FILE ANALYSISWriting file analysis emerged fatal error. is Possible on the disk is no more free space ?| ?|123|12345678901|12345678901|12345678901|12345678901|12345678901 APhysic. LBA| Your # | Parent #|Cl.beg.data|Fr.| Size |D| Date created | Date adjustment|Tyr|HD|LD|Log. sector|Log.cluster|#Sec|Ext|Analysis of the physical disk area X 12345678901 - 10987654321 logical X: N ..| | |...|.| || | ||||. |. .||| X 12345678901 - 10987654321 X: 12345678901234567890 %3d |LBA | LBA | FR | FR | . A | LBA start | LBA end | FR start| FR end | Chain size Read blockRead sectorReOpen blockReOpen sector LBA | | | LBA |Physical address| Command |Error code 12345678901| 123456-123-12 |123 | 12345 12345678901|123456789|123456789|12345678901|123|12345678901||gggg.mm.dd xx:xx|gggg.mm.dd xx:xx|123| ?|? |12345678901|12345678901|1234|123| 1234567890123.. xxx FAT FAT FAT !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~""-%5d ! : LBA -12345678901 ( - 123456 - 123 - 12) - 12345 ? - - - ERROR READ OPERATION SECTORS! Failure is detected read operations sector at: LBA -12345678901 (Cylinder - 123456 Head - 123 Sector - 12) Kod error - 12345 TO GIVE FURTHER DETAIL ABOUT THE CRASH? Yes - Each time report the address of the bad sector No - To continue work without the error message Cancel - To quit a program  () FAT () FAT E .Select drive and directory to write files analysis. . , . , , , - . . .You misspelled the folder to write files analysis. Therefore, as this folder will be installed directory where the program is running. If You want to analyze the disk, where is program, specify a folder on a different physical logical disk. This can be a network or flash drive. Folder to write files analysis is incorrectly specified. . , , . , . .You have incorrectly specified a folder for recording photo files. You cannot specify a folder on the problem disk, which can result in permanent data loss. Specify a folder on another drive. The folder for recording photo files is incorrect. . - . - , . CONFLICT SETTINGSFor the analysis of this logical drive, you should change file location analysis. These files cannot be written down on the analyzed logical drive. Analysis files can be recorded on a flash drive and network drives, writable. . - , . - , . CONFLICT SETTINGSFor the analysis of the physical disk, you should change file location analysis. These files can not be record on logical drives, located on analyzed the physical disk. Analysis files can be recorded on a flash drive and network drives, writable. . .INCORRECTLY SPECIFIED LOGICAL DRIVETyped the letter nonexistent logical drive. ENTER THE DRIVE LETTER. . .NCORRECTLY SET TO THE PHYSICAL DISK.Enter a non-existent physical disk. ENTER THE NUMBER OF THE PHYSICAL DRIVE. Microsoft Offoce / search Filter files by their extensions Microsoft OffoceArchive filesEmail filesApplication FilesUser ExtensionFiles graphic formatsMedia filesProfessional digitalSearch filter files according to their initial characters namesFiltering remote/current files SETTING THE FILTER FOR FILE SELECTION (*.rar) (*.zip)Files archives (*.rar)Files archives (*.zip) 1 2 3 4Your extension 1Your extension 2Your extension 3Your extension 4 (*.gif) (*.tif) (*.jpg) (*.avi) (*.mp3) (*.wav) Nikon (*.nef) Canon (*.cr2)image files (*.gif)image files (*.tif)image files (*.jpg)Video (*.avi)Music (*.mp3)Audio files (*.wav)Pictures Nikon (*.nef)Pictures of Canon (*.cr2) Disable filtering files by nameSearch availableSearch deletedpicturesApplyApply MFT To ignore the chain of records in the MFT less than LBA HDX DRIVE HD X LOST READINESSADDRESS OF CURRENT DISK SECTORStart fragmentHeadSectorCylindersCylindrAddr.LBACONTINUESystem error codeUSB HD HD3 ! . . - - . : 1 - USB - , . 2 - USB, , . . , , .Drive HD3 lost readiness! This is due to a technical malfunction of the hard disk. To recover data from this disk you want to copy read from this disk sector to another healthy drive. And only after that to perform the procedure of retrieving data from a sector of space which will be able to count. To assess the amount of possible losses you can continue to work: 1 - If the drive is connected via USB and has no separate source of power, enough to pull out and reinsert the interface cable. 2 - If the drive is connected via USB, but it does have a separate power should be turned off and on again. After manipulation of the power discs waiting when it will be deter- ned by the system and click CONTINUE. In case of further problems with the loss of readiness disk, You can change the scan area, omitting a number of sectors.L LBA / FAT :Current physical addressCurrent LBAReadLeftSpeed Kb/SecFailuresFiles and foldersTable of contents folder FATRECORDS IN THE FILESSTRUCTURE ELEMENTS::::Cylinder:Head:Sector: MFT (FILE Record) NTFS () NTFS FAT FAT () FAT FAT MFT MFT Item description of Total Actual RemoteRecord MFT (FILE Record)Files NTFSFolders NTFSElements tables FATFiles FATFAT folders . Item description Total Root Und.folder FragmentsNumber tables foldersSectors of contentsBoot sectorsPrimary sectors FATPrimary sectors $MFTTaking into account chain of records longer than MFTPARTITIONS FoundSTOPPING , ? .Are you sure you want to stop the application?Command to stop the work.Left before the end , . - , . , - . ! ? MASTER FILE TABLE IS CLEARED OF OLD DATAAn operation of cleaning master file table from the traces, placed it in short files and long files provisions and their fragments on a disk device. This operation is sufficient for most practical cases, since you can now only find fragments of the files by scanning the whole space of the disk. If You want to exclude even this possibility, we need to zero out unused at the present time the region of the disk.. However, this operation may take a long time! TO PERFORM A FULL RESET NOT A BUSY AREA? . , . , . ! ? DIRECTORY IS CLEARED OF TRACES OF DELETED FILESAn operation was performed to clear the existing directory tree from the names and location of deleted files. This operation is sufficient for most practical files by scanning the entire disk space. If you want to exclude even this possibility, you you need to reset the currently unused area of the disk. However, this operation may take a long time! TO PERFORM A FULL RESET NOT A BUSY AREA? Disk DISK X:/?:\TmpNameBlok1234567.tmp x: . , - ! Unused logical drive x: set to zero. To restore the contents of this area, actually existing technologies IMPOSSIBLE!FREE SPACE CLEANUP COMPLETED () , . .Enter the ID (letter) logical drive on which You want to destroy the information.INCORRECTLY SPECIFIED LOGICAL DRIVEOn your computer, no such disk. . ! Windows . CLEAREnter the alpha character ID of the logical disk. ATTENTION! Before cleaning the disk, you must delete private data by regular means of Windows and be sure to CLEAR the trash. CLEAR LOGICAL DRIVE FROM OLD DATA12345678901234567890NTFS INCORRECTLY SET PHYSICAL DISK , ! , , USB .You cannot destroy data on the physical disk that contains a logical drive with this program! Write a program to another drive, for example, in flash or USB drive. .You cannot destroy data on the physical disk with the operating system. ! : " ". On flash drives and maps replace the data boot sectors are not! To clear them, delete their private data and use the function: "Zeroing the Unallocated sectors of logical drives" INVALID NUMBER OF WINCHESTER .The number of the hard disk must be specified in a single number. .On your computer, no such disk. INCORRECTLY SET THE LOGICAL DRIVE LETTER .The identifier of the logical drive must be a letter. .On the computer this logical drive. () LBA LBA SELECTION OF A PHYSICAL DISK FOR AN INEVERABLE ERASE WITH IT INFORMATIONCLEARThe number of the physical drive (HDD)Start zeroingCylinderLBAHeadSectorThe end of the field resetCylinderAddress LBASectors of allHeadSector The disk is not selected HDSelected physical disk HD HD1 - The program folder - ? . , , MFT , , . ? All information on a given area of the disk ? deleted without possibility of recovery. To continue using this drive, if markup tables, MFT, or boot sectors have been affected, you must restart the computer, split this hard drive into logical drives, and format them. RESTART YOUR COMPUTER RIGHT NOW? PERMANENTLY DELETE DATA COMPLETED? ! . , E-mail Fomsoft. !INCORRECTLY SPECIFIED PHYSICAL DISK NUMBER! Enter the sequence number of the physical disk. If You are uncertain of the correctness of Your actions, you can seek free advice by E-mail in the lab data recovery Fomsoft.THE ORIGINAL DISK IS NOT SET UP PROPERLY! . , E-mail Fomsoft, - c . Enter the serial number of the hard disk. If You are not sure in correctness of Your actions, you can get free advice by E-mail in-lab data recovery Fomsoft, or to use a paid service remote ambulance on the Internet for professional help diagnose problems with Your computer ! <>, , <>. ! !You have requested permanently delete data from the hard drive On this disk the information on all logical drives! Click , if You really want to destroy your data. If You doubt the correctness of the decision, click . ATTENTION! THE DATA WILL BE IRREVERSIBLY DESTROYED! ! , : 12345678901234567890 ( ), . ? FOUND UNFINISHED WIPING PROCESS DATA! When you run the program discovered information that previous process of destroying data on a hard disk with serial number: 12345678901234567890 (Disk x), fully negaverse. Continue the interrupted cleaning process? FomsoftDataRecoveryEraserHD.ini??????????????????????????????????????????????????\\.\PhysicalDrive0 : 12345678901234567890 , . , . ? Previous process of cleaning the hard disk is not completedthe observed fact of an unfinished process of zeroing a hard disk with serial number: 12345678901234567890 the Process of zeroing out the hard drive impossible to continue, as now it is not connected to the computer. If you want to continue the process of resetting, You need to connect this drive to computer and run the program again. To resume the previous process of zeroing the hard disk? HD1 XFINDCleanLDVHDVLDxX ! ! . , - . . , . ? The process of cleaning the logical disk stopped!The process of cleaning the hard disk stopped!You force stopped the process of cleaning the hard disk. In so doing, it left the data that it is possible to recover the special software. The program saved restore point to restore the process. When run, the program will find a cleaned hard drive by serial number and offer to continue the interrupted process. Do you really want to stop the cleaning process? ::Clearing:Left to clear: :: ::: LBA / IRREVERSIBLE DESTRUCTION OF DATA ON DISKDELETION OF DATA WITHOUT POSSIBILITY OF RECOVERYProcessed:Left:To stop immediatelythe Current physical addressCylinder:Head:Sector:Current LBASpeed MB/CBad sectors CHOOSING A PHYSICAL OR LOGICAL DRIVE FOR PHOTOS () FomsoftPhotoRecovery.binFILE SIZE (B)SCANNED AREASOURCE DISKFolder for recording analytical file FomsoftPhotoRecovery.binFIND LBA LBAMminimumMaximumStart LBAFinal LBA Letter logical diskPhysical drive numberor - *.jpgSET TIME INTERVAL FIND PHOTOSstarting date range searchYearMonthDayend date range searchYearMonthDayDevice modelPhoto templateTo enable the filter selection of photos by dateSearch for all files * .jpgCourier Newd <1980120191231 . . . , , , . A logic error is detected within the preset search parameters. The values of some parameters is invalid. These parameters are replaced by a logically valid. Check the new values of all parameters, and, if they do not suit You, then adjust them. CORRECTED ERROR IN SEARCH SETTINGS . . , - . Recording folder analytical file is incorrectly specified.You have incorrectly entered the folder to write files analysis. Therefore, as of this folder will be set to the directory from which the program is running. () . Error indications of the sample file to extract the names of Luggage (devices) the desired images. SAMPLE FILE NOT FOUND . . The specified file does not contain the image. Specify a different fileTHIS FILE DOES NOT CONTAIN THE IMAGE () . , : " " , . ! The specified template does not contain the name of the camera (devices) which made these pictures. If You really want to find a similar picture, you can select: "Search for files of other image formats". However, in the extracted images can get a large number of unnecessary images containing digital garbage. If You are sure in correctness of Your choice confirm it! IN THE TEMPLATE NO NAIMENOVANIYA CAMERA MODEL . , () . . , - , . , - , . . , ! *.JPG. , , , , . , . ! , ! You have selected the file search mode other image formats. This mode allows you to extract photos taken by cameras, tablet computers and mobile phones that do not produce timestamps for shooting images, as digital cameras do. However, a large number of other image files that are not photos can get into the extracted images. If You are sure in correctness of Your choice confirm it! Be carefu, possible error!You have chosen mode of selection of photos by the date they were taken. Note that in camera (device) date may be set incorrectly. In this case, to find the right pictures will not give the desired results. If You are sure that the date photos installed correctly, give the affirmative answer. This will set the maximum range of dates, which You can change by selecting the desired range. Otherwise search by date will be disabled.Be careful, possible error! : - . - . CONFLICT SETTINGSID of the disk should consist of a single character: - For a physical disk that is its serial number. - For a logical drive that is his letter. , . . , USB . , E-mail Fomsoft, - . CHECK THE PHYSICAL DISKCannot specify a physical disk, which will be enroll analytical file. SPECIFY DIFFERENT DISK FOR RECORDING THIS FILE. For example, a flush or a USB external disk. If You get stuck in the correctness of Your actions, you can apply for a free consultation on E-mail or use in the laboratory data recovery Fomsoft, paid service remote East of the formation of data on the Internet. , . . , USB . , E-mail Fomsoft, - . CONFLICT PARAMETERSCannot specify a logical drive, which will be enroll analytical file. SPECIFY DIFFERENT DISK FOR RECORDING THIS FILE. For example, a flush or a USB external drive. If You get stuck in the correctness of Your actions, of the can apply for a free consultation on E-mail in the laboratory data recovery Fomsoft, or use paid service remote East of the formation of data on the Internet. ! . .THE PHYSICAL DISK,NO!Disk with the serial number on your computer is missing. Enter the correct disk number. . . !Disk with the drive letter identifier on your computer is missing. Enter the correct disk number.THIS LOGICAL DRIVE IS NOT! PHYSICALSEARCH PHOTOS ON LOGICAL DISK FomsoftPhotoRecovery.binVD_Foto\\.\PhysicalDrive0\\.\?:\\.\PhysicalDrive0Fomsoft Photo Recovery V-7.02 - -- : ... HD? ....... .. - . . . . . LBA LBA WAIT_Foto SEARCH PHOTOS ON YOUR DISK - FOUND PHOTOS - LBA ::: the Current physical addressCurrent LBAReadLeftSpeedOf them failuresSETTINGS LATEST NAIDENNOI, FOTOGRAFIFOUND PHOTOGRAPHSCylinder:Head:Sector:Camera modelcreation dateSOTOP . . , , . ?Disk scanning is stopped.You stopped the process of scanning the disk. This may be due to Your desire to make use of what is found, or you want to complete the work without the use of the results of the scan. To continue the work of the program? !!! Fatal situationUnfortunately on this disc photos NOT FOUND !!! -MM- : 1234567 - -- : x: 1234567 , , . A search is executed - -- : Was set physical disk x: Found photos 1234567 If You want to view, then YES, otherwise it will be made new search.FOUND THE RESULT OF PREVIOUS SEARCH : DrNTFS.find ! LBA: 1234567890123 1234567-123-12 . : 1234567890123 A : : MM+WW+Jet DBAC10GIFMM*II*{\rtFLhdExtendedRIFFAVCDWAVERar!PK8BPSPGPdMAIN`!BDNϭ%!PSAGD4[HEAD]MSCFITSF?_COM+II*NIKOExifJFIFJPEGOther JPGSmartphonePhotoshop 3.0LBA LBA CylinderHeadSectorLBA addrCylinderHeadSectorLBA addr THE BEGINNING AND END OF THE SEARCH AREA ON THE SELECTED DISK The sector address of the beginning of the search The sector address of the end of the search THE PHYSICAL DISK Ddisk Capacity Volume label i ID flushSEARCH , SEARCH SIGNATURE ENTERED FROM THE KEYBOARD ENTER SIGNATURE AND INSTALLATION SECTION OF DRIVE TO SEARCH Search from offset Search in sector area FILE SELECTION MASK, AND THE AREA ON THE DRIVE TO SEARCH SELECT FILE WITH THE CONTEXT AND PLOT ON THE DRIVE TO SEARCH - . 512 . .No. plot. The file is divided into sections with a length of 512 bytes. Numbering of the sections begins with zero. . 0 511 0h 1FFh . , . 512.offset to the start of the search string relative to the beginningof selected section. The offset is from 0 to 511 in decimal form orfrom 0h to 1FFh in hexadecimal representation.String length search image search only in decimal form. The sum of offset and length should not be more than 512.PARAMETERS OF THE SEARCH PATTERN ON THE MASKThe name of the sample fileFolder ? .SEARCH FOR MATCHESLeft before operation completes ?FoundSpeed KB.ReadLeftSTOP00000000EGqG , (512 ). . , . GG () 512 . . . , . ( ).HD? 12345678901234567890.txtL\\.\PhysicalDrive0FomsoftDiskEditorLOG.txt--########12#21####### Content-Disposition: form-data; name="name" G --########12#21####### Content-Disposition: form-data; name="email" J --########12#21####### Content-Disposition: form-data; name="filez"; filename="test" Content-Type: application/applefile Content-Transfer-Encoding: binary --########12#21####### Content-Disposition: form-data; name="indlang" L --########12#21####### Content-Disposition: form-data; name="help" I --########12#21#######-- */*GContent-Type: multipart/form-data; boundary=########12#21####### Accept-Encoding: gzip, deflate Host: www.antivirus.ru Content-Length: 1234567 Connection: Keep-Alive Cache-Control: no-cache Fomsoft Response server Laboratory Fomsoftwww.antivirus.ruG/PHP/FomsoftDataRecovery_/FomsoftDiskAnalyzer.phpFomsoftDataRecoveryPOSTFomsofDataRecovery. FomsofDataRecovery.FomsofDataRecovery.This is a free version of FomsofDataRecoverywww.antivirus.ru--########12#21####### Content-Disposition: form-data; name="name" G --########12#21####### Content-Disposition: form-data; name="email" J --########12#21####### Content-Disposition: form-data; name="indlang" L --########12#21####### Content-Disposition: form-data; name="filez"; filename="test" Content-Type: application/applefile Content-Transfer-Encoding: binary --########12#21#######-- */*GContent-Type: multipart/form-data; boundary=########12#21####### Accept-Encoding: gzip, deflate Host: www.antivirus.ru Content-Length: 1234567 Connection: Keep-Alive Cache-Control: no-cache Fomsoft /PHP/FomsoftDataRecovery_/Help.phpؽGFomsoftDataRecoveryPOST ....... .. REQUEST A FREE CONSULTATION Your nameE-mailE-mail DESCRIBE YOUR PROBLEM AS DETAILED AS POSSIBLE " " . , , , , - "@". . . .Description of the situation too meek. Describe it in more detail. "E-mail" , . The field "Your name" is blank or contains invalid data. They are permitted only digits, Latin or Russian letters, symbols dot, hyphen, underscore, or "@"Error input data.The field "E-mail" is not filled, contains incorrect data or has an incorrect format.(xxxxxx ........ 9 ........ 8 ...... 7 .... 5 ........ ( ) , , , . ... 12 +10 +15 TO REQUEST THE LICENSE INSTANCESEND A LICENSE REQUESTDATA ABOUT THE USERHow to contact YouYour email addressTHE NUMBER OF LICENSED DISKSOne disc....... 9 the diskTwo discs...... 7 the diskFive discs..... 8 the diskTen discs...... 5 the diskTen discs...... FREE (Approval of execution capability is required) The free license is provided for charitable purposes, for valuable comments and suggestions for improving the program, as well as for all who have submitted their test results. DELIVERY TIMETwo days...... for free12 working hours + 10 3 working hours + 15 FINAL COST OF THE LICENSEafter confirmation paymentor one disc two discs five discs ten discs License for Delivery time 1234567890123456789012345 Total cost - 40 USD or xxxx RUB iup to forty-eight hours no more 12 working hours not more 3 working hours 1234567890123456789012345 - 40 EUR xxxx RUB o 12 3 " " . , , , , - "@". . "E-mail" , . . The field "Your name" is blank or contains invalid data. They are permitted only digits, Latin or Russian letters, symbols dot, hyphen, underscore, or "@"Error input data.The field "E-mail" is not filled, contains incorrect data or has an incorrect format.You choose the type of license.www.antivirus.ru--########12#21####### Content-Disposition: form-data; name="name" G --########12#21####### Content-Disposition: form-data; name="email" J --########12#21####### Content-Disposition: form-data; name="indlang" L --########12#21####### Content-Disposition: form-data; name="tarif" J --########12#21#######-- */*GContent-Type: multipart/form-data; boundary=########12#21####### Accept-Encoding: gzip, deflate Host: www.antivirus.ru Content-Length: 1234567 Connection: Keep-Alive Cache-Control: no-cache Fomsoft , ! FomsoftDataRecovery .Response from server Fomsoft When attempting to transfer data, there was a fatal problem! The licensed version of the program Fomsoft Data Recovery can work only if you have access to the Internet./PHP/FomsoftDataRecovery_/ReqLicenz701.php2GFomsoftDataRecovery701POSTwww.antivirus.ru--########12#21####### Content-Disposition: form-data; name="name" G --########12#21####### Content-Disposition: form-data; name="email" J --########12#21####### Content-Disposition: form-data; name="indlang" L --########12#21####### Content-Disposition: form-data; name="filez"; filename="test" Content-Type: application/applefile Content-Transfer-Encoding: binary --########12#21####### Content-Disposition: form-data; name="tarif" J --########12#21#######-- */*GContent-Type: multipart/form-data; boundary=########12#21####### Accept-Encoding: gzip, deflate Host: www.antivirus.ru Content-Length: 1234567 Connection: Keep-Alive Cache-Control: no-cache Fomsoft Response from server Fomsoft /PHP/FomsoftDataRecovery_/FomsoftDataRecovery.phpGFomsoftDataRecoveryPOST " " . , , , , - "@". . "E-mail" , . . The field "Your name" is blank or contains invalid data. They are permitted only digits, Latin or Russian letters, symbols dot, hyphen, underscore, or "@"Error input data.The field "E-mail" is not filled, contains incorrect data or has an incorrect format.You have not chosen tariff plan. E-mail HDx EUR RUB.2. "" .3. 8 22 . 1. - , 10 eur 600 .Your nameE-mailTO ORDER A PROGRAM OF DATA RECOVERY FROM HDxTHE PARAMETERS OF THE ORDER FOR MANUFACTURE DATA RECOVERY PROGRAM Tariff plan order EUR RUBNOTE.2. The rate of "Emergency" requires the prior consent of the technical capabilities of its execution.3. Working hours is the interval from 8 to 22 hours Central Time (CET).1. Consultations are paid additionally based on the cost of one hour equal to 10 EUR or 600 RUB. A - $14 800 . A - $20 1200 . A - $26 1500 . A - $34 2000 . B - $24 1400 . B - $30 1800 . B - $36 2100 . B - $44 2600 . Economy A - twenty-four working hours $14 or 800 rub.Normal A - eighteen working hours $20 or 1200 rub.Quick A - twelve working hours $26 or 1500 rub.Extra A - two working hours $34 or 2000 rub.Economy B - twenty-four working hours $24 or 1400 rub.Normal B - eighteen working hours $30 or 1800 rub.Quick B - twelve working hours $36 or 2100 rub.Extra B - two working hours $44 or 2600 rub.SEND ORDER24181202 0 MFT ! MFTError parameters of the alleged MFT fragment Enter the parameters again!Incorrect parameters of the MFT fragment MFT MFT File Record NumberLogical driveRecord number , "", , E-mail .To restore all the photos, click "RESTORE" fill out your name, address, E-mail and select the plan of payment of manufactu- ring recovery program. VIEW THE FOUND PHOTOSDownUpHomeEndShow photo #Camera modelDate and time ofNAVIGATIONRESTORE INCORRECTLY SPECIFIED LOGICAL DRIVE , ! , , USB . , , NTFS.You cannot scan the logical drive, from which the program is running! Write the program to another disk, for example, on a flash or USB drive.The specified logical drive, or missing, or its file system is different from NTFS. I: NTFS ....... .. ...... ..... : -- : 1234567 () 1234567 h E8P0P 2P 5P9P2JBoot sector NTFS Boot sector FAT32 Boot sector FAT16 LBA LBA -THE SELECT PHYSICAL DISKS AND A RANGE OF SECTORSDESCRIPTION OF THE FRAGMENT ON THE SOURCE DISKFragment start addressLBA start fragmentationEnd address or number of sectors in a fragmentLBA end of fragmentor sector number THE INITIAL ADDRESS OF FRAGMENT ON FINAL DISKAsymmetric copyingCreate a new protocol of the programSOURCE DISKPHYSICAL DISC PARAMETERS YPE SERIAL NUMBER CAPACITY RECORD FINAL DISKCOPY DISK DISK 12345678901234567890 -1 12345678901 12345678901 12345678901234567890 -2 12345678901 ??:??:?? : ??:??:?? : ???:??:?? 1234567 123 12 LBA 12345678901 .......... 1234567  . . The cloning of the specified parcel is complete. . . Cloning is stopped by the user. Source drive Output drive Beginning source area Ending end source area Beginning output area :Started: : Passed: : Remained: Cylinder Head Sector Bad sectors Average speed of copying kilobytes per second Cloning complete ::: LBA / THE PROCESS OF CLONINGCurrent physical addressCylinder:HeadSector:Current LBARead outRemainedSpeed kb/secWrong sectorsTo stop the program : : :Neglected: Passed: Remained:: ??:??:?? : ??:??:?? :???:??:?? hh:mm:ss RANGE of RECOVERABLE IMAGESStarting number of the recoverable picturesAmount of recoverable photosCancelExtract allExtract the rangeCreate folders from camera nameCurrent physical addressCylinder:Head:Sector:Current LBARead sectorsRemaining sectorsSpeed bytes/secSEARCH FORMATTED FILES AND FOLDERS (DIRECTORIES)Left until end ofSTOPFORMATTED FILES AND FOLDERS AGAIN THE RECORDED FILES AllActualDeletedFiles found allOne of them filtered outThe size of the filter (MB)Found folders (directories)Files found allThe size of the new data (MB)Folder of the new file systemTREATMENT FOUND INFORMATION ABOUT FILESIf all of the formatted data is found, You can stop the search for them, not waiting for the viewing of the entire logical drive to the end. ! . , ! ? FORMATTED DATA NOT FOUND!You stopped scanning. However, formatted data has not been found yet! to Continue the process of scan ? ! . , ! FORMATTED DATA NOT FOUND!Targets the whole given drive. However, formatted data not found! FomsoftUnFormatNTFS_D.tmp .Select the drive and folder to write the extracted files. !, . , , . ?File12345.jpgSmartphone00000.jpggggg-mm-dd_hh-mm-ss_000.jpg : THE PROGRAM HAS FINISHED THE WORKPhotos were successfully extracted to the specified folder:  RemovedWe must learnStop immediatelyEXTRACT FOUND PHOTOGRAPHS Left */*8HContent-Type: multipart/form-data; boundary=########12#21####### Accept-Encoding: gzip, deflate Host: www.antivirus.ru Content-Length: 1234567 Connection: Keep-Alive Cache-Control: no-cache www.antivirus.ru--########12#21####### Content-Disposition: form-data; name="name" G --########12#21####### Content-Disposition: form-data; name="email" J --########12#21####### Content-Disposition: form-data; name="indlang" L --########12#21####### Content-Disposition: form-data; name="filez"; filename="test" Content-Type: application/applefile Content-Transfer-Encoding: binary --########12#21####### Content-Disposition: form-data; name="tarif" J --########12#21#######-- H"H/PHP/FomsoftDataRecovery_/FomsoftPhotoRecovery.php ! , , . VISA, . . Thank you for your order for the restoration of pictures! To check the correctness of specified e-mail address, which will be sent to retrieve the program found data, sent a letter. In a letter to the VISA payment card number, which you can make payment. The order will be executed after you confirm the need for its implementation and the corresponding payment. FomsoftDataRecoveryPOST " " . , , , , - "@". . "E-mail" , . . The field "Your name" is blank or contains invalid data. They are permitted only digits, Latin or Russian letters, symbols dot, hyphen, underscore, or "@"Error input data.The field "E-mail" is not filled, contains incorrect data or has an incorrect format.You have not chosen tariff plan. - FOUND PHOTOS - Your name E-mailE-mail PARAMETERS OF ORDER FOR RECOVERY USD Tariff USD Rubles , E-mail .After sending the request to the specified E-mail address will receive a letter to confirm address and control methods of payment. : NOTE: 1. "" Fomsoft. 1. Tariff plan "Emergency" requires prior approval of the technical possibilities of its implementation in the Laboratory Fomsoft.2. 8 22 - (Central European Time).2. The working hours is considered to range from 8 to 22 pm CET (Central European Time).3. Fomsoft $10 600 .3. Payment Fomsoft engineering work is carried out separately at the rate of $ 10, or 600 per hour. 4. .4. Consultation by e-mail free of charge. $11 660 . Twenty-four working hours $11 or 660 rub. $14 840 . Eighteen working hours $14 or 840 rub. $20 1200 . Twelve working hours $20 or 1200 rub. $27 1620 . The extra two o'clock $27 or 1620 rub. SEND ORDERA !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~@x #$% 8PhT5` \p d(H@ X~p$<0 0H` x`t j8lP&h v  ~(@X4pF 0H ` x~ x     0  @  P  `  p                        0  @  P  `  p                        0  @  P  `  p                        0  @  P  `  p                        0  @  P *Q hZpR>PD(Bx hGȈ`T @F dZH6H Ƚ^.`?`1*Vp:Zh\BuHY !;N>/28h:@4R. =BH( *  hpz0Al:  F0CLEANLDDDDZZ WRIT_CLONV_DISKWDPFFIND_UFVDUNSNEXTRACTVIEWITOG WAIT_FOTOVD_FOTOFND_WRITFINDCFINDSFINDK ENDANALIZDD1DDPSCANVDNVLDFINDVHDHELPWAITRVNMFTORDERVNMFTVV_BOOTV_MFTV_FRVDLICINFOLICENZPASSSETPARVPSECTORVP_GPTMENU1L_SCR_SCPROSFILTRRILTRAILTRFILTVWAITWAITPWAITZIND_WRITHD_OFFʐ }(m " # +% ! !" !Courier NewP # +%  !" !!"/P(! HD0P Pmsctls_progress32Progress1P6VP6`P<. 1@01>B0=>PG<, ?P6VP<# AB0;>AL:P<+ ?PUS_ @5:@0B8BL =5<54;5==>* +  $'!% !   !" Courier NewP _QPPR! $ "  !% !PS0G0;L=K9 04@5A D@03<5=B0 P#- TPY#hULBA =0G0;0 D@03<=B0P9!V>=5G=K9 04@5A 8;8 G8A;> A5:B>@>2 2 D@03<5=B5 PE- W PQBd XLBA :>=F0 D@03<5=B0 PQLZ Y8;8 G8A;> A5:B>@2P#Z',+  ! $ "  ' ! P- [P,t ]AA8<5B@8G=>5 :>?8@>20=85P5 `!>740BL =>2K9 ?@>B>:>; @01>BK ?@>3@0<<KXMa~ ", !-!PsAda!%+ ! P( b 1 P( c 2 P( d 3 P( e 4 P( f 5 P( g 6 P( h 7 P( i 8Pnimj " + $'!% !Pztk " ! +   !", !, Pwl5AB:89 12345678901234567890 1234,5 123456 Pwm5AB:89 12345678901234567890 1234,5 123456 Pwn5AB:89 12345678901234567890 1234,5 123456 Pwo5AB:89 12345678901234567890 1234,5 123456 Pwp5AB:89 12345678901234567890 1234,5 123456 Pwq5AB:89 12345678901234567890 1234,5 123456 Pwr5AB:89 12345678901234567890 1234,5 123456 Pws5AB:89 12345678901234567890 1234,5 123456 PZqAdt'+ ! Pp u 1 Pp v 2 Pp w 3 Pp x 4 Pp y 5 Pp z 6 Pp { 7 Pp | 8 1Courier NewP* " ! +   !", !, P,1111111111111111111111111111111111111111111111111111P  1P,1111111111111111111111111111111111111111111111111111P  2P,-1111111111111111111111111111111111111111111111111111P - 3P,;1111111111111111111111111111111111111111111111111111P ; 4P,I1111111111111111111111111111111111111111111111111111P I 5P,W1111111111111111111111111111111111111111111111111111P W 6P,e1111111111111111111111111111111111111111111111111111P e 7P,s1111111111111111111111111111111111111111111111111111P s 8Ph2APPLYʐ}(!%  &!!  /Courier NewP 1 P2 msctls_progress32Progress1P -3 "5:CI89 D878G5A:89 04@5AP7 4 &8;8=4@:P27 5 P_7 6 >;>2:0:P7 7 P7 8 !5:B>@:P7 9 P-F: "5:CI89 LBAP7< ; P KF< !G8B0=>PU< = PiKK@ AB0;>ALPnU< A PKFB !:>@>ABLPW< C Pbs[F !1>9=KE A5:B>@>2Ps}7 G PaZJ AB0=>28BL ?@>3@0<<C? '`",  " + &' MFT  ! /  "#,9 !" #&Courier NewP'U$+ / !'"  "   "#, !P/@V$LBA M;5<5=B>2 D09;>2KE AB@C:BC@ 4;O 8<?>@B0P3iW$03@C7>G=K9 A5:B>@ @07;5;0 8;8 53> 5>?8O P- X$P' Y$@8<0=8BLP2)iZ$4@5A =0G0;0 B01;8FK MFT 8;8 55 :>?8O P*- [$P+' \$@8<0=8BLP2;i]$$09;>20O 70?8AL D09;0 87 ?5@2>3> D@23<5=B0 MFT P<- ^$P=' _$@8<0=8BLP/R``$AE>4=K9 D878G5A:89 48A:PNZa$" ! ++   !", P:a $ P:k $ P:u $ P: $ P: $ P: $ P: $ P: $PPab$123 PPkc$123 PPud$123 PPe$123 PPf$123 PPg$123 PPh$123 PPi$123 P()j$ " +  "#, !P1m k$0G0;> 28@BC0;L=>3> 48A:0 P- l$P' $@8<0=8BLP1k o$ 07<5@ :;0AB5@0 2 A5:B>@0E P- p$P' $@8<0=8BLP Z$ ! $ "  $ "&+  "#, !P Kq$ ! LBA =0G0;0 LBA r:>=F0 ! LBA =0G0;0 LBA :@=F0P $1 P*- r$ P_- s$P $2 P*- t$ P_- u$P $3 P)- v$ P_- w$P- $4 P)-- x$ P`-- y$P $5 P- z$ P- {$P $6 P- |$ P- }$P $7 P- ~$ P- $P- $8 P-- $ P-- $PeK]$#! !" #&% 7+  !% !  / $ / !Courier NewP $H#!%+ !Po8#0G0;L=K9 04@5A D@03<5=B0 P)- #P9#>=5F D@03<5=B0P P- #P% #LBA 04@5AP+ P4+ #P:s#" # !", '+ $@PA{#123PR}#"5:CI89 :0B0;>3P O!!# !+ $PZ #P:q# " + !+% #!" !"PY# TYPE SERIAL NUMBER CAPACITY PF # 1 PF # 2 PF # 3 PF # 4 PF # 5 PF # 6 PF # 7 PF # 8P3#!",PQ((# ",P(# ",P3(# ",P79#'8A;> A5:B>@>2P_#11111111111111111111111111111111111111111111111111P_#11111111111111111111111111111111111111111111111111P_#11111111111111111111111111111111111111111111111111P_#11111111111111111111111111111111111111111111111111P_#11111111111111111111111111111111111111111111111111P_#11111111111111111111111111111111111111111111111111P_#11111111111111111111111111111111111111111111111111P_#11111111111111111111111111111111111111111111111111ʐ,}(#! "$ " +% $   Courier NewP hPimsctls_progress32Progress1P /"5:CI89 D878G5A:89 04@5AP9 &8;8=4@:P29 .P_9 >;>2:0:P9 .P9!5:B>@:P9 .P/A"5:CI89 LBAP92..P H8!G8B0=>PR-.PLH<AB0;>ALPQR2.PH:!:>@>ABLPR2.PH>!1>52PT2.Ph A53>Ph. :BC0;L=K5Ph* #40;5==K5P q:"$ " +E $+   Pz[$09;>2 =0945=> 2A53>Pz+k111Pz+l112Pz+m113P]7 =8E >BD8;LB@>20=>P+n121P+o122P+p123Pv 07<5@ >BD8;LB@>20==>3> (M1)P+q131P+r132P+s133Px1=0@C65=> ?0?>: (:0B0;>3>2)P+t141P+u142P+v143P P "  (/  & !P "P0j!"",PA;8 K C25@5=K, GB> 2A5 >BD>@<0B8@>20==K5 40==K5 =0945=K, <>65B5 >AB0=>28BL 8E ?>8A:, =5 4>6840OAL ?@>A<>B@0 2A53> ;>38G5A:>3> 48A:0 4> :>=F0.  I+  '! !Courier NewP Po,2@8<5=8BLP 2548B5 1C:2C ;>38G5A:>3> 48A:0 A D09;>2>9 A8AB5<>9 NTFS f +%  MS Sans SerifP  0G0;L=K9 =><5@ 872;5:05<>3> 87>1@265=8O P( P '8A;> 872;5:05<KE 87>1@065=89 P( P I;B<5=8BL PKI;72;5GL 2A5PIF72;5GL 480?07>=P 1 !>74020BL AC1:0B0;>38 A =08<5=>20=85< D>B>:0<5@KDg' +% $" $MS Sans SerifP : Pmsctls_progress32Progress1P2( 72;5G5=>P2 P21 04> 872;5GLPF2 PAL[ AB0=>28BL =5<54;5==>ʐ !"  +%  Courier NewP P.- ?5@54Pm. 0704P.  =0G0;>P.  :>=5FPJ PJ !P9 >45;L :0<5@KPU 0B0 8 2@5<O A>740=8OPiR 2011-09-00 66:66 55PLo ...P ; &/P? !!"",P  ;O 2>AAB0=>2;5=8O 2A5E =0945==KE D>B>3@0D89, =06<8B5 :=>:C !!"",, 70?>;=8B5 A2>5 8<O, 04@5A E-mail 8 2K15@8B5 B0- @8D=K9 ?;0= >?;0BK.ʐ}(# EEEEE  Courier NewPoE " ", P?( 0H5 8<OPe| P?$ E-mailPe$| P  " +   !!" +% $" $P5< "0@8D=K9 ?;0= USD C1;8 P,J 204F0BL G5BK@5 @01>G8E G0A0 $11 8;8 660 @C1. P,T Eighteen working hours $14 or 840 rub. P,^ 25=04F0BL @01>G8E G0A>2 $20 8;8 1200 P,h -:AB@5==K9 420 G0A0 $27 8;8 1620P$6?P$6P  >A;5 >B?@02:8 70?@>A0, =0 C:070==K9 04@5A E-mail ?@845B ?8AL<> 4;O :>=B@>;O 04@5A0 8 ?>4B25@645=8O A?>A>1>2 >?;0BK 70:070.P   ': P  1. "0@8D=K9 ?;0= "-:AB@5==K9" B@51C5B ?@5420@8B5;L=>3> A>3;0A>20=8O B5E=8G5A:>9 2>7<>6=>AB8 53> 8A?>;=5=8O 2 01>@0B>@88 Fomsoft.P  2. 01>G8<8 G0A0<8 AG8B05BAO 8=B5@20; A 8 4> 22 G0A>2 ?> F5=B@0;L- =>52@>?59A:><C 2@5<5=8 (Central European Time).P  3. ?;0B0 @01>BK 8=65=5@0 Fomsoft ?@>872>48BAO >B45;L=> 87 @0AAG5B0 $10 8;8 600 70 G0A @01>BK.P  4. >=AC;LB0F88 ?> M;5:B@>==>9 ?>GB5 15A?;0B=K.ʐ}(#!  Courier NewP PP Qmsctls_progress32ProgressP #R"5:CI89 D878G5A:89 04@5AP- S&8;8=4@:P2- T123456P_- U>;>2:0:P- V123P-W!5:B>@:P- X12P#<Y"5:CI89 LBAP-2Z1234567890P <<[!G8B0=>PF2\1234567P<<]AB0;>ALPF2^1234567P<=_!:>@>ABLPF2`1234567PQ<<a7 =8E A1>52PVF2b1234567P Z#c " + !  $" $Pd7d>45;L :0<5@KPKdg e.Pn7f0B0 A>740=8OPKnR g.PZU#h $" $Pi0 i.Px2jAB0=>28BLʐ(}(+  $'!  '! ! / ! $" $   Courier NewP MP3N!PD( OPD( PP q&V   $ ()P- Z8=8<0;L=K9P!- [0:A8<0;L=K9 (KB)P0 QP0 RP &W! #+ #'!"P5 \0G0;L=K9 LBAP!1 ]>=5G=K9 LBAP!_ ^C:20 ;>38G5A:>3> 48A:0P! _ _><5@ D878G5A:>3> 48A:0PI `8;8P &X!%+ !PmY 4;O 70?8A8 0=0;8B8G5=A:>3> D09;0 FsPotoRecovery.bin@PuS123P(xqT"5:CI89 :0B0;>3P1:a#!"",   "  ! $" $P ;b=0G0;L=0O 40B0 480?07>=0 ?>8A:0PG c>4 PF dP9He5AOFPQF fPjG g5=LP~F hP;i:>=5G=0O 40B0 480?07>=0 ?>8A:0PG j>4 PF kPHl5AOFPF mPG n5=LP F oP(2u-p>45;L CAB@>9AB20X-=k q@P.Lr123PENTs$>B>3@0D8O - H01;>=P8[ t:;NG8BL D8;LB@ >B1>@0 D>B>3@0D89 ?> 40B5 AJ5<:8P)bs u>8A: 2A5E D09;>2 *.jpgʐ }(m! !. Courier NewP #AB0;>AL 4> 7025@H5=8O >?5@0F88 ?P #msctls_progress32Progress1P27#0945=>.P =+ #?PA27#!:>@>ABL 1.PD=0 #?P}27#!G8B0=>P=0 #?P27#AB0;>ALP=2 #?P_T7#AB0=>28BL+ 3 "!"  #'!" ! / !Courier NewP8'"'  & !" !  +  !P C$"4@5A A5:B>@0 =0G0;0 ?>8A:0PI XS a" XS b"PS "&8;8=4@ X:R" c"P]S ">;>2:0 X{R d"PS "!5:B>@ XR e"PIePS% "LBA 04@5A XR- f"PBb"$'! !PN"48A: <:>ABL 5B:0 B><0 88  D;MH PN j"HD0 5AB:89 1234,5 1 123456 255 63 1024 PN k"HD1 5AB:89 1234,5 1 123456 255 63 1024 PN l"HD2 5AB:89 1234,5 1 123456 255 63 1024 PN m"HD3 5AB:89 1234,5 1 123456 255 63 1024 PN n"HD4 5AB:89 1234,5 1 123456 255 63 1024 PN o"HD5 5AB:89 1234,5 1 123456 255 63 1024 PN p"HD6 5AB:89 1234,5 1 123456 255 63 1024 PN q"HD7 5AB:89 1234,5 1 123456 255 63 1024X3r"!",P h$"4@5A A5:B>@0 :>=F0 ?>8A:0Pn Xx z" Xx {"Px "&8;8=4@ X;w" v"P^x ">;>2:0 X{w w"Px "!5:B>@ Xw x"PnePx% "LBA 04@5A Xw- y"P  ~"P$0""!" ! P #| ">8A: :>=B5:AB0 A> A<5I5=8O P" ">8A: 2 ?@545;0E 2A53> A5:B>@0 P" "6 2+  $ ! !  #'!"  ! / !Courier NewP'" " +  & / !  !P "08<5=>20=85 >1@07F0 D09;0P- i"P +"0?:0P5 h""5:CI89 :0B0;>3P F"! CG0AB:0. $09; CA;>2=> 45;8BAO =0 CG0AB:8 4;8=>9 ?> 512 109B. P M"C<5@0F8O CG0AB:>2 =0G8=05BAO A =C;O. XH s"P W"!<5I5=85 =0G0;0 AB@>:8 ?>8A:0 >B=>A8B5;L=> =0G0;0 2K1@0==>3> P ^"CG0AB:0. !<5I5=85 70405BAO >B 0 4> 511 2 45AOB8G=>9 D>@<5 8;8P f">B 0h 4> 1FFh 2 H5AB=04F0B5@8G=>9 D>@<5 ?@54AB02;5=8O.X\ t"P q";8=0 AB@>:8 ?>8A:>2>3> >1@070 ?>8A:0, B>;L:> 2 45AOB8G=>9P x"D>@<5. !C<<0 A<5I5=8O 8 4;8=K =5 4>;6=0 1KBL 1>;LH5 512. Xr u"P'"'  & !" !  +  !P $"4@5A A5:B>@0 =0G0;0 ?>8A:0P X a" X b"P "&8;8=4@ X:" c"P] ">;>2:0 X{ d"P "!5:B>@ X e"PeP% "LBA 04@5A X- f"@Pg"123PDw"$'! !PO""8? 48A:0 <:>ABL 5B:0 B><0 88 BL PM j"1 5AB:89 1234,5 1 PN  k" 2 5AB:89 1234,5 1 123456 255 63 1024 PN l" 3 5AB:89 1234,5 1 123456 255 63 1024 PN m" 4 5AB:89 1234,5 1 123456 255 63 1024 PN* n" 5 5AB:89 1234,5 1 123456 255 63 1024 PN5 o" 6 5AB:89 1234,5 1 123456 255 63 1024 PN@ p" 7 5AB:89 1234,5 1 123456 255 63 1024 POK q" 8 5AB:89 1234,5 1 123456 255 63 1024Xf3r"!",P $"4@5A A5:B>@0 :>=F0 ?>8A:0P X z" X {"P "&8;8=4@ X;" v"P^ ">;>2:0 X{ w"P "!5:B>@ X x"PeP% "LBA 04@5A X- y"6 2+  $ ! "!"  #'!"  ! / !Courier NewP'" " +  & / !  !P "08<5=>20=85 >1@07F0 D09;0P- i"P +"0?:0P5 h""5:CI89 :0B0;>3P F"! CG0AB:0. $09; CA;>2=> 45;8BAO =0 CG0AB:8 4;8=>9 ?> 512 109B. P M"C<5@0F8O CG0AB:>2 =0G8=05BAO A =C;O. XH s"P W"!<5I5=85 =0G0;0 AB@>:8 ?>8A:0 >B=>A8B5;L=> =0G0;0 2K1@0==>3> P ^"CG0AB:0. !<5I5=85 70405BAO >B 0 4> 511 2 45AOB8G=>9 D>@<5 8;8P f">B 0h 4> 1FFh 2 H5AB=04F0B5@8G=>9 D>@<5 ?@54AB02;5=8O.X\ t"P q";8=0 AB@>:8 ?>8A:>2>3> >1@070 ?>8A:0, B>;L:> 2 45AOB8G=>9P x"D>@<5. !C<<0 A<5I5=8O 8 4;8=K =5 4>;6=0 1KBL 1>;LH5 512. Xr u"P'"'  & !" !  +  !P $"4@5A A5:B>@0 =0G0;0 ?>8A:0P X a" X b"P "&8;8=4@ X:" c"P] ">;>2:0 X{ d"P "!5:B>@ X e"PeP% "LBA 04@5A X- f"@Pg"123PDw"$'! !PO""8? 48A:0 <:>ABL 5B:0 B><0 88 BL PM j"1 5AB:89 1234,5 1 PN  k" 2 5AB:89 1234,5 1 123456 255 63 1024 PN l" 3 5AB:89 1234,5 1 123456 255 63 1024 PN m" 4 5AB:89 1234,5 1 123456 255 63 1024 PN* n" 5 5AB:89 1234,5 1 123456 255 63 1024 PN5 o" 6 5AB:89 1234,5 1 123456 255 63 1024 PN@ p" 7 5AB:89 1234,5 1 123456 255 63 1024 POK q" 8 5AB:89 1234,5 1 123456 255 63 1024Xf3r"!",P $"4@5A A5:B>@0 :>=F0 ?>8A:0P X z" X {"P "&8;8=4@ X;" v"P^ ">;>2:0 X{ w"P "!5:B>@ X x"PeP% "LBA 04@5A X- y"ʐ}(4!   #'!" ! (Courier NewP+  !", .!"#. !#,"&.Pe  +", P$( 0H5 8<OPJ|  P! E-mailP| P " !>740=K 4803=>AB8G5A:85 D09;K A 8=D>@<0F859 > =0945==KE AB@C:BC@0E D09;>2KE A8AB5<: P|# 1. FomsoftDiskAnalyzer.txt A>45@68B 04@5A0 A8AB5<=KE D09;>2 $AttrDef,P3|$ 2.  D09; FomsoftDiskAnalyzerSTRING.txt ?><5I5=K F5?>G:8 D@03<5=B>2 70?8A59 ;02=>9 D09;>2>9 B01;8FK (MFT). PG|% 3. FomsoftDiskAnalyzerMAXI.txt. FomsoftDiskAnalyzerMINI.txt 8 FomsoftDiskAnalyzerUSER.txt 8<5NB >48=0:>2CN AB@C:BC@C 8 >B;8G0NBAO @07;8G=K< A>AB02>< B8?>2 70?8A59 D09;>2KE AB@C:BC@. P\|& 4. $09; FomsoftDiskAnalyzerDISKI.txt A>45@68B ?5@5G5=L D878G5A:8E 8 @0A?>;>65==KE =0 =8E ;>38G5A:8E 48A:>2. Pn|' 5. $09; FomsoftDiskAnalyzerERROR.txt MB> 04@5A0 A1>9=KE A5:B>@>2 8 :>4>2 A8AB5<=KE >H81>: 8E GB5=8O. P| ( 6. $09; FomsoftDiskAnalyzerMBR.bin A>45@68B A>45@68<>5 =C;52>9 4>@>6:8 ?@>1;5<=>3> 48A:0. P g) " ",  !  FOMSOFT  !"#. !#,"&. Pq6* P, @0B:>5 >?8A0=85 ?@>1;5<K (4> 500 7=0:>2): ++  $'!% !   !" Courier NewP7C ",P  4@5A AG8BK205<>3> A5:B>@0P P aP &8;8=4@(P7" PZ >;>2:0(Px P !5:B>@(P P* 4@5A LBA(P- PD-]!8AB5<=K9 :>4 4H81:8(PU79 P Pq8<2=85 ++  $'!% !   !" Courier NewP7C ",P  4@5A AG8BK205<>3> A5:B>@0P P aP &8;8=4@(P7" PZ >;>2:0(Px P !5:B>@(P P* 4@5A LBA(P- PD-]!8AB5<=K9 :>4 4H81:8(PU79 P Pq8<2=85ʐQ}(+7=0;87 CG0AB:0 ;>38G5A:>3> 48A:0 ?: =0 65AB:>< 48A:5 HDE Courier NewP  P  msctls_progress32Progress1P # "5:CI89 D878G5A:89 04@5AP-  &8;8=4@:P2-* .Pe-  >;>2:0:P-  .P- !5:B>@:P-  .P#E "5:CI89 LBAP-9 .P <@ !G8B0=>P F< .P<A AB0;>ALPF6 .P<E !:>@>ABL 1/A5:PF2 .PP<A 7 =8E A1>52PSF9 .Pu< !"",P T $09;8 8 ?0?:8PZ ?8A0=85 M;5<B0 2A53> 0:BC0;L=KE C40;5==KEP a'Ph 0?8A8 B01;8FK MFT (FILE Record)Ph .Ph .Ph .Pr $09;K MFTPr .Pr .Pr .P| 0B0;>38 (?0?:8) MFTP| .P| .P| .P (P -;5<5=BK >3;02;5=89 FATP .P .P .P $09;K FATP .P .P .P 0B0;>38 FATP .P .P .P  3;02;5=8O :0B0;>3>2 FATP P  ?8A0=85 M;5<5=B0 2A53> :>@=52K5 AC1:0B0;. $@03<5=BKPk '8A;> >3;02;5=89 :0B0;>3>2P{ .P .P .P .P] !5:B>@>2 2 >3;02;5=8OEP{ .P .P .P .P1 !  $%PNDiskAnalyzerUSER.txtP .PSDiskAnalyzerMAXI.txtP .P[DiskAnalyzerMINI.txtP .P[DiskAnalyzerSTRING.txtP .P 1 -" !" #"# PY 0945=> Pj .PY 03@C7>G=KE A5:B>@>2Pj .PY 0G0;L=KE A5B>@>2 FATPj .PY 0G0;L=KE A5B>@>2 MFTPj .P"( #G8BK20NBAO F5?>G:8 70?8A59 B01;8FK MFT 4;8==55P) . \+  ! /  $+% !" #"# Courier NewP P ( #"'" 480?07>= A5:B>@>2 0=0;878@C5<>3> CG0AB:0P) 0G0;L=K9 P@; P& >=5G=K9 P; P ( #" ;>38G5A:89 8;8 D878G5A:89 48A:P^ C:20 ;>38G5A:>3> 48A:0P  8;8P#^ ><5@ D878G5A:>3> 48A:0P7 #" :0B0;>3 (?0?:C) 4;O 70?8A8 D09;>2 0=00;870@P? 123P,Aw "5:CI89 :0B0;>3P E1 0AB@>8BL ?>8A:P NTFSP FATPB<  ",P(7 $8;LB@ ?>8A:0 a'!"", '! ! " #!" (% +%Courier NewP R2548B5 1C:25==K9 845=B8D8:0B>@ ;>38G5A:>3> 48A:0P1  Px2'!"",ʐ}( " # +% ! !" !Courier NewP # +%  !" !!"/P(! HD0P  Pmsctls_progress32Progress1P 2"5:CI89 D878G5A:89 04@5AP< &8;8=4@:P2< .P_< >;>2:0:P< .P< !5:B>@:P< .P2F"5:CI89 LBAP<< .P PF!G8B0=>PZ< PiPKAB0;>ALPnZ< PPF!:>@>ABLP\< Paw_@5:@0B8BL =5<54;5==> 3|+  $'! ! /  " !" / !  $ &Courier New Pg Pg2 '!"",Pi The number of the physical drive (HDD)P# 0G0;> >1;0AB8 >1=C;5=8OP P kP +P+kP C P , Cylinder P LBA P9" P] >;>2:0 Pz P !5:B>@ P PB P($8 >=5F >1;0AB8 >1=C;5=8O P 6, Cylinder P6 LBA P NF Sectors of all P:6" P]6 >;>2:0 P{6 P6 !5:B>@ P6 P6C PYL< ʐ}( ! !" !#,"&Courier NewPWeN  !", !#,"&.P2 (O 0H5 8<OPX | P P2Q E-mailPX| R P5S (" (#  #    PIoT ʐ}("  (/  &!!Courier NewP P&PQ&msctls_progress32Progress1P\a_H&@5:@0B8BL =5<54;5==>P -I&"  (/  &P=;J&8?8A0=> PH/ R&Pg:IK&!:>@>ABL /!5:PtF/ S&P=;L&AB0;>AL PH/ T&P u/M&"5:CI89 2>AAB0=>2;8205<K9 D09;P N&0?:0PI U&PO&$09;PJ V&(@ @NOOlmolmmyxxHGFXYZ`a`rss\000YYXsuuDBBBA?jkjkki^_^)))\4^__|}}nooxyxssraa`\][=<:onmxz{;<<\2===褤qrrwxy__^tuvyyxFCB}~~GJJ 6BAA䵵510dcbQQP2/.||{^^^;;9hij TTTVWW⫫bb`pppx|zLZNtsr\\]jkkvvu$%$TSQBA@~~~~zit#!rssponhki222ZdedNOOclgdvԳ8>8MLKsttHHH BBBoWVURQP}{}Ϋ^u{԰ݻlrpAA>LKJxyy,(&MML)!!!\YZZmlmWVU}ٺװrcu[zgı^uu}>LA{{{B?>mlmxxx>@@;wxxklmghgKKKUTTx̡֫ԩجŝLhW621#O`VezԺFGG742jkm22/TTS;:8oooxyxxyxҩԧԧدͫMVP.+)?<9944)*$lw׹Ow]RURB?REn|QVTXXXeee,,,.,*tttuјWxPeXa}٩֦^zgmjQdWkkʐax_kdYYZ(G!!!G򲲳_nDrS=WD^ziZhKwYRs_lwWz`ȇcUk'''6,,,4sssZZZv~y*'$0,+MKISSSIGF1.,401yzzV{WZʂX_pddd><:aaauvwijkowIpWFuVNcQjZwxgggx %%%::7CCBEEDTUUNOOegiZZZ@>=0-+2/-Sw````q888;;;;=;;;=;;;=;;;=;;;=;;;=;;;=NMLyzzdccRU[ghjxz{vwxooo<<9v ^^^bbbbfbbbfbbbfbbbfbbbfbbbfbbbf$$$%110vmkkMOO|vwy|||<<;2225 <<϶Y\`[\]fghWVUfffo~~~AA@pon)))o3339GGHfTUTcdcrrrvvwmnnQQPrssdddPPP郃{{{ggeccchiirttSQP`adz}RUZ KKI{|}___[[[fttslpusw~643xyzprujmsilpkmqfgd?>DDDEEDHHHA@?TTSonnqqp[\\w֘~~kkkoTTTzoony}|IHFZZX0.,\`g*%%tts=<:VY_BA@$,(&HFE``_PPO"520NOOZ[[ghibbczzprrkq~||zdde}>>;TRQkji20/hpty{~VVWzxJHFbdfxOPQbccbfnggghXXXzqsvabaVSSdee`aahii&"!BBAhhizkovGHL2.-lq|_^[ikl]^_yzzhfa½CCCu}VZfIIIM z{{VWWlr|,('}inwONKovkpwtutILOlqz!sz%%%9缼TUVnnofff=<;vwxx~XYXķvuqlosKKJcdd\^_|||uuufffTTT:87\]`cdddjujp~UVTLNR~ MMMvwwEEEĿ|~ZZZ111= jkk~QSTmr|x{z|~ MLK~~WXXy{~ rsr}~~bcewy{ ]^_wv}ov{z|~ ;;;=RRSсVXZ|HIMRUZQSYOPT} lklzUUU߄`cdlll###1))*+oqqrtvhhg焄ppplmm:97XWWSSRmmm../4FEC}~tuu}}}wxy++-DDDRnnnRRR20/opolmmIJJwwvbfnjkkuut10/LLL455DDDRnmmQQPEEDmnndddFFFGggfqqp{{{]]]==;787DDDRgfe.+)PPOkml酅 3334osxttuPPP[bbbgzzzdedLLLkll---CDDRiih0/-A@@QRQGGGHfggA@?ho{{~_`_===B]^^[\[210KKKR::8A@@hhhw2226bbbDDDWY[UV[x~txikkMNM<<;ZZZ\:98! XXWefe~~}545=`aaefgkkiRSS`aaklnms~xrvzlqz_adghh|{xSTS@?>}~~ZZZ\::9@A@EBBBfCCCf0005SSRvwxggffgfhihhhhgggps{vyA@>654ZZZ\RRSf***ERRRZGGGLLL>>>?jllh}?Y_vnnnAA@DDDH=V#@ =AZ\pQPPA@@666p4446PjIc'D#@E^643nnnNNNc|Pi742`_^rssRRQFEEeee!BBBCXXXghhXXXMLKefe``` 999VNNNwxwlllllkkkklnoSSS><;976BAAZ[Zlmmlkl,,,LLLbbbv   bbb**)v\\\\ \ \\\\\NNN}?s??( @ XXXRPOvvuUUW#$$Q{{z||{BCC+++mfoj CCCrrr~~ŰQRO\]]UUUhggҷ|hsvyuUSRklluttnooppoթЩ?G@b`^hkhgtm|RQOssr122]---ZpqqwzXrbˡa`_i~Wm_yyy)))c;;;>)))+../KKXOvXjJMJFQIg~~WWWbTTT\tSwalkvc^s(('0]]]xzxfedzxxjijOjTtuIIHXJIIگ}~\ZYc{lIIIU 111311131113!!!#++*frxuuu QQQgoooEhhhkkkrv|_^]kll++,8qsu[]`uttqu|~~HFFTW_<;9?>=\]\NLKwwv}}}...=xv|dccXZ`000=hmzgilcddurn~}zPPPklpx;87yɽv~vvtQRTLLLe^_^llktvv ijjyyyijjgggppqoppggg+++0kkl~777Gyyymml mmm㹹[[[""")`__UUTiji၈VUU~~~""")LJHTTS6667~---0BBBNZZZ:87sssoooDDDVhii{}~wzGGFpqpNNNfFEE!!!+'nnnBBAqrr+\\]pB[awUUU }E_XVUPPPgggded[[[JJJDDD@@@+))&$$::9+**,,,KXXX?_(   ;;;n@ͨlvq|BCCjdoiz[i Ar{{~!!!) ''')!!!"MMMLLLIz~nmmNNNX *}ʿȼHHHTccclmmmmmUUT___{}ĴTRRhhhHHHﯲZZY...[cccw...^(y{{؆rtt<<< @@ (B   h( @3333p333303333{33330{{{p𿷷{ ( @ppw{{ ( wwwwwwpwwwwwwpppppppppppwwwwww{pppppwwwwxwwww("Toooooffffooooooooooofff`(  UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUdJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6dJ6@@@@@@@@@UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUtC/0JtC/0JUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU߸඙ⴕⱑ䯌孈櫄秀{xdJ6߸඙ⴕⱑ䯌孈櫄秀{xdJ6߸඙ⴕⱑ䯌孈櫄秀{xdJ6߸඙ⴕⱑ䯌孈櫄秀{xdJ6߸඙ⴕⱑ䯌孈櫄秀{xdJ6+++BgNNNNNNNNN6+++BgNNNNNNNNN6+++BgNNNNNNNNN6UUUUUUUUUUUUUUUUUUUUUUUUvAMpՋwKtvAMpՋwKtUUUUUU|dJ6|dJ6|dJ6|dJ6|dJ6+++HpZXXXXXXWS+++HpZXXXXXXWS+++HpZXXXXXXWSUUUUUUUUUUUUUUUUUUUUUUUUZRwv[hZRwv[hUUUUUU֮֮֮֮֮֮私dJ6֮֮֮֮֮֮私dJ6֮֮֮֮֮֮֮私dJ6֮֮֮֮֮֮֮私dJ6֮֮֮֮֮֮私dJ6&&&Sr^YB,6&&&Sr^YB,6&&&Sr^YB,6UUUUUUUUUUUUUUUUUUUUUUUUo4Vv|՜9uo4Vv|՜9uUUUUUU欅dJ6欅dJ6֮֮欅dJ6֮欅dJ6欅dJ6+++++++++UUUUUUUUUUUUUUUUUUUUUUUU2AG^uNJԜޜVG<2AG^uNJԜޜVG<UUUUUUb*K K K BBB<6x2֮֮䮊dJ6b*K K K BBB<6x2֮֮䮊dJ6w: p3m4i3d4^4X4S4M4I5֮䮊dJ6N!|N!|LxHqEjAb= Z9S6L4H֮䮊dJ6E^BZ=S8L3D,<'4!,$v֮֮֮䮊dJ6وMg<g<g<g<g<g<g<g<g<P2وMg<g<g<g<g<g<g<g<g<P2وMg<g<g<g<g<g<g<g<g<P2UUUUUUUUUUUUUUUUUUUUUUUUr'LW^N<:XkabDxr'LW^N<:XkabDxUUUUUUi:x2㱏dJ6i:x2㱏dJ6!}?M5㱏dJ6[04H֮㱏dJ6Ha[t07.6[t |㱏dJ6XŧXXWVVVTTTXŧXXWVVVTTTXŧXXWVVVTTTUUUUUUUUUUUUUUUUUUUUUUUU9.LHL}whED9.LHL}whEDUUUUUUtI/a86f@6֮֮ⳕdJ6tI/a86f@6֮֮ⳕdJ6,Fp9^5\~`R4֮֮֮ⳕdJ6d;ɼW'|7N֮֮֮ⳕdJ6Kf9G]jh[/9(֮֮֮ⳕdJ6&&&ŵcݤטэˁvj_SP2&&&ŵcݤטэˁvj_SP2&&&ŵcݤטэˁvj_SP2UUUUUUUUUUUUUUUUUUUUUUUU* )?;Ši&** )?;Ši&*UUUUUU{UmUZ:ȷ66к<֮඙dJ6{UmUZ:ȷ66к<֮඙dJ69Ow<o:c6?Hh;X4֮඙dJ6nGW'6Ly: U֮֮֮඙dJ6OkD_^qk\D_%1඙dJ6+++++++++UUUUUUUUUUUUUUUUUUUUUUUU*!46:𵴴i@`*~@j8*!46:𵴴i@`*~@j8UUUUUUՊg~gjDu]6[2m>(B֮޸dJ6Պg~gjDu]6[2m>(B֮޸dJ6GXRXĖX["q;mp^4֮֮֮޸dJ6xT鴣W'V:x6L~?^֮޸dJ6Sq4;ggo-5,<֮֮֮޸dJ6]PPPPPPPPPP]PPPPPPPPPP]PPPPPPPPPPUUUUUUUUUUUUUUUUUUUUUUUU?^kN=Aİ['['̐kz%ה$fz?^kN=Aİ['['̐kz%ה$fzUUU3UUUՑwՑwjD߼L!ݤZ:ɛB֮ݺdJ6ՑwՑwjD߼L!ݤZ:ɛB֮ݺdJ6TaϖƚX['}:(h2c4֮ݺdJ6`˷وhi8HpʿCg֮ݺdJ6Xw-5B{Tj/Ojt-54GݺdJ6 oZZZZZZZZSP oZZZZZZZZSP oZZZZZZZZSP3UUU3UUU3UUU3UUU3UUU3UUU3UUU3UUUrͅXh{Ua]*['ɘjҋ$̚=rͅXh{Ua]*['ɘjҋ$̚=3UUUUUU枀ڜ}_ܹjDܧjMwK ܼ֮֮ݻeK7枀ڜ}_ܹjDܧjMwK ܼ֮֮ݻeK7_gēej5BptXa;Gi3ܼ֮֮֮ݻeK7lݲۚ|ִ_3ʿHoܼ֮ݻeK7\}D_ V+YgD_;Pܼ֮֮֮ݻeK7&&&Sޕׇ}ylcZ]&&&Sޕׇ}ylcZ]&&&Sޕׇ}ylcZ]UUUUUUUUUUUUUUUUUUUUUUUUIXXÀWvK_,n"˃(IXXÀWvK_,n"˃(UUUUUUUUUUUU饉ڜ́`́`ܤmUݤK ﷢eK7eK7eK7饉ڜ́`́`ܤmUݤK ﷢eK7eK7eK7gm“`dHRU^U^m3﷢eK7eK7eK7w܁d[8zLw֮﷢eK7eK7eK7_9G V3:-+AX﷢eK7eK7eK7Tb hb hb hb hb _ScTb hb hb hb hb _ScTb hb hb hb hb _ScUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUq8eo}SwLʺb)sBq8eo}SwLʺb)sBUUUUUUUUUUUU櫓K ﹤źeK7櫓K ﹤źeK7gm p3﹤źeK7N!|﹤źeK7bD_3:3:H]E^﹤źeK7TKzFOKzOKzP9 wTTKzFOKzOKzP9 wTTKzFOKzOKzP9 wTUUUUUUUUUUUUUUUUUUUUUUUUaRϓȿ}SwL׿uJf5haRϓȿ}SwL׿uJf5hUUU癙UUU櫓櫓饉枀ؗ|Պg~XwRnBb*eK7櫓櫓饉枀ؗ|Պg~XwRnBb*eK7gmbi[eS_IZ@S6M-G%B{>eK7МʕxËlaxTnGd<[0S(eK7bb`\|XwTqOkKeHaE^eK7T o o,t'k,t'k,t'kTT o o,t'k,t'k,t'kTT o o,t'k,t'k,t'kT癙UUU癙UUU癙UUU癙UUU癙UUU癙UUU癙UUU癙UUUuMwМ詵asGxTmuMwМ詵asGxTm癙UUU²ԾҽѺϹͶ˶ʴ²ԾҽѺϹͶ˶ʴ²ԾҽѺϹͶ˶ʴ²ԾҽѺϹͶ˶ʴ²ԾҽѺϹͶ˶ʴ!T]ccccccccc]X!T]ccccccccc]X!T]ccccccccc]X|K0=|K0=(  Ⱦ}{zxvuƛged[YXTQQCA@6330.-865:77GDDywv訦ywvywvyxwϺ~rqpoonllkDCA  "" 񺸷HFE&#"=98kfeyvrKHD$$! "#!NPM! !nomxvu,*) &"!'! 510ᙔURR]YYqnl2/+%! '(&{|z!" !"#!  str;;:! %$$"## 421jhh! +(&LIF)*)YYXbcb998###%%$786KJIWVUSSPSSOjjgNOM!"! """ !!000~~~AAA ,*)$"!#! ! !!"%%%"""  453UVTDEB !!%%% !! !!!! 643 ###%%&;:;竫rsqLML222 """'&& !!!966! !!!!!! CCCϱrrryyyOOO!!!"""!!!$$$977%$$  !!! ccc橩UUU%%% !!!$$$$$$;99zxv#""NMNmmm  !""=:;뺸{xw!""###!!!%%%&&&'''%%%,+,222454;<:??>_^]222!!! ?<>ϠwwsYWU><;$""-*+423777:::<<>MJLOMNNNNPPPWWWYYYXXXVVVVVV[[[[[[UUUUVSZ[YNNL;98SPP窪```!!!"""### LIK_]\&$"-,(A@<;YVVߕvtqcc`nlnzzzeee777 WSU\YX2/.NLK[ZXZXWVSSWUUZWYXWXVWVUUUUUUWWWVVVTTTXXXVVVSSSVVVYZWXZWLKI@>=ZXWoonHHFIIGDDCGGGMMMAAA000'''$$$!!![YZ`__443UTT_^^ZYYTSRTSSUUUUUUUUUUUUTTTVVVVVVUUUVVVUUUUUUUUUVVUXXXKKJ=>=@?>VVVXXXSSSVVVWWWTTTUUUUUUUUUUUUTTTTTTUUUVVVWWW\\\JJJ(((///IIIYYYVVVTTTTTTUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUTTTYYYSST==>^]];:9;:9[[\YYYTTTVVVVVVTTTUUUUUUUUUUUUTTTTTTUUUVVVWWWZZZEEE%%%000MMMZZZUUUTTTUUUTTTUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVVVRRRUUUVVVFEFPON䦤532>=<\\\XXXXXXUUUSSSTTTUUUUUUUUUUUUTTTTTTUUUVVVXXXYYYAAA###444PPPYYYTTTUUUUUUSSSUUUVVVUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVVVRRRSSSVVVLMLDBBtrqӠhed754EEEYYYVVVYYYTTTRRRTTTUUUUUUUUUUUUTTTTTTUUUVVVXXXUUU<<=@>=POOVVVSSSXXXVVVSSSTTTUUUUUUUUUUUUTTTTTTUUUWWWXXXPPP666###???WWWXXXTTTVVVUUUSSSUUUVVVUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUSSSTTTVVVTUU><<?<8988:;rquϛwwwtttYXV310TRQYYXTTTWWWVVVUUUTTTTTTUUUUUUUUUVVVUUUTTTUUUXXXZZZ@@@$$$///NNNYYYUUUVVVTTTTTTUUUVVVUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVVVWWWUUUTTTVVVWWW@??VSR񮮮III @@@jjjxvv;97   |z}Ɨttstssllk<<ҟ~~~bbb444RRRZZZUUUUUUXXXVVVVVVTTTSSSWWWVVVQQQLLLIIIKKKRRRTTTJJJ...&&&CCCSSSVVVRRRQQQSSSSSSSSSQQQQQQQQQSSSSSSSSSSSSRRRPPPPPPOOONNNJJJNNNQQQNNNJJJJJJDDDIIIúrpoZXWA??...011===SSShhhuuuƤtttKKK %##֟sssnnnddd999YYYYYYSSSTTTXXXVVVUUUVVVXXXUUUSSSPPPLLLEEEFFFJJJKKK>>>&&&%%%DDDQQQPPPKKKLLLKKKMMMNNNKKKMMMNNNNNNMMMMMMKKKJJJIIIJJJJJJJJJEEEHHHLLLLLLJJJOOOEEECCCʧ׺===---III;vtsxvuۄBBB>>>YYYUUURRRTTTVVVSSSPPPRRRTTTMMMJJJKKKKKKIIILLLQQQJJJ666$$$,,,HHHOOOLLLIIIJJJHHHJJJMMMJJJIIIKKKKKKKKKKKKIIIHHHHHHIIIJJJKKKIIIGGGJJJJJJHHHMMM@@@IIIӭiii666pppAAA222CCCRRRMMMNNNPPPPPPNNNMMMLLLMMMMMMIIIGGGFFFEEEJJJRRRLLL333)))888LLLMMMKKKMMMOOOLLLOOORRROOOMMMMMMOOOOOOPPPNNNMMMLLLKKKLLLMMMLLLHHHHHHJJJIIIKKK@@@FFFϭ…~~~ڪrrr{{{嵵222333LLLPPPLLLPPPPPPLLLNNNNNNLLLLLLQQQGGG999111,,,,,,222444""",,,777555444:::===:::;;;>>>===???@@@BBBDDDGGGHHHIIIIIIJJJKKKLLLMMMKKKJJJNNNNNNNNNFFFGGGzzz俿ǵǖӶkkk```wwwTTT 555KKKJJJGGGLLLKKKHHHLLLNNNNNNOOOMMM555"""&&&+++%%%!!!%%%!!!%%% ###$$$ %%%((((((***,,,///333777:::===???BBBEEEEEEGGGGGGHHHEEEEEEbbb맧տ̰̔UUU///888555222)))%%%###(((000555;;;BBB???&&&---fff{{{uuupppmmmhhh```ZZZVVVRRRJJJEEE@@@999222,,,'''###  !!! """(((***--->>>簾Ը๹~HHHVVV~~~iiiaaa^^^]]][[[PPPCCC===777444111(((!!!!!!***~~~vvvpppkkkddd```[[[SSSKKKFFF===///,,,ttt˷¸ԩħ៟TTT¹ppp^^^OOOEEE===!!!ʺ|||hhhccciiijjj\\\iiiඵч׶ĪؘYYYʌFFF^^^ņ~~~ξՠ___zzzʮ{{{UUU___ڤWWWlllLLL쓓uuu嗗AAAFFFȿͨ~~~;;; '''mmmᴴTTT񄄄???ꕕwwwۤ}{{󧧧:::666Ƚ}~{ܻnnn111eeeݲSSS000󞞞{{{㩨vtsccc&&&}}}õ||||||ssssssQQQ+++III˙PPP555޽ީywv BBBȿsssdddSSSXXXwwwРMMMLLLhhhﮮkkkPPPRRRTTTVVVVVVSSSSSSTTTRRRQQQPPPPPPPPPPPPOOOMMMMMMOOONNNLLLKKKLLLLLLLLLKKKKKKFFF\\\ިwvukkkCCCfffLLL٥sssvvvwwwvvvvvvxxxwwwvvvttttttsssrrrrrrrrrqqqoooooopppooommmmmmmmmllljjjiiiiiieeeuuuᨦusr]Y^ƥݾؽ}}}{{{777䀀666zzz񌌌mmmߩvut=>A%&'wwwfffiiikkkrrrwwwwwwuuuvvv|||~~~~~~]]]ޠfffݷŻ>>>񝝝000򳳳YYYܪ}|.33233wwwgggrrr~~~}}}}}}|||zzztttpppjjjeeefffkkkqqqwww}}}ċlllⓓବJJJ111uvuNNN•~~~}}}||||||{{{{{{{{{yyyyyyxxxxxxwwwvvvvvvwwwuuutttrrrrrrnnnڧ}|*1,464󖖖TTT|||nnnddd]]][[[aaaiiipppvvv|||˅ᎍrrrPPP}}}==>dddQQRꚚLLL111:::===999777777666666333444333444444555444444333333333222333444333222111111+++BBBܤzxw&/&564lll|||wwwuuuvvvyyyzzzwwwrrrpppuuuSRUutvSRU^]`]]^Ÿݥyzw")"8:8vvvxxx~~~ҹ_^`~kjlYXZpoqܥ{{z ?@Aqqq{{{~~~yyyxxx~~~gfhUTVwvxܥz{yHHHlllsrtWVXutvtsuŗ}}}|||zzzyyyyyyzzzxxxwwwxxxtttݦwxvPOOnnn`_a]\^ↅTSU魭oooQQQTTTZZZWWWRRRRRRTTTTTTRRRRRRRRRRRRRRRQQQPPPOOOOOOQQQPPPNNNNNNNNNNNNNNNLLLMMMGGG]]]ݦwxv WVU󗗗ooopoqonppoqQPRzy{yxz׽ݤwxv ]\[𖖖oooedfPOQ_^`xwyݣvwv fee쑑oooWVXVUX^]_qprޣvvu􈈇 ono獍oooA@Ba`c繹ZY[볳yyy___]]]___`````````^^^^^^\\\\\\\\\[[[[[[[[[ZZZZZZYYYYYYXXXVVVVVVWWWWWWWWWVVVVVVQQQgggަvwv򁁆 vvw挌qqqqprxwyihjywz󶶶|||{{{䋉~vuwﻻmmmmmmoooooonnnmmmmmmllljjjjjjjjjjjjjjjjjjiiiiiihhhhhhgggddddddeeeeeedddcccccc^^^qqqަwxvvu{ ~~ኊsss]\^ّzz{`_a甔}}}}}}ﮭZY[¿ݥxxvkih نttt\[]򲱳FII餤~фihjgfhݥyyyfda ԃttt~\[]簯LNN֚՚hgjߏrqsݥyyy_]\ tttjikqpr좡jikàXZZ~[Z\ݥyyyXVU |||uuu~}vuw󪩪xwyȥbddٍDCEutvݥyyyPMLzzzuuuYWZONP˟prr657cbdݥyyyIGFxxxuuuQPRCBDۈnppKJLIHJݥyyyDB@" vvvsssa`bA@C{z}飯]__POQCBEݥzzz?=;)'&sssrrrrps0/1WVXUWWWVX768ɤݥzzz976.,+nnnppp楤AACSRS[__?>@oopݥzzz542/-,jjjooosrs757hll}~~CBD~}򣡤Ӎݥ{{{0--643󺺺jjjqqqCBCz{{yyzEEFyyzڥ|||ݥvvv)&&@?>򶶶llluuu૪KKM~vuvACE|~єuuu℄ަqqq'%%DBB𳳳nnnxxx÷ԘSSUX[\󧧧vvwDFGy{|˝}}}ަqqq򒐐&##JHHooozzz}}}׬ͰZY[:;<{{|ޖBDEY[\񄄄[[[ަqqq#!!QOOꦦqqq}}}jik,./ꄃwvx^]_@BC\^_aaaަqqq!VUU柟uuuƐ```ԅ%'(ihj΀ƾ<>?npq𕕕NNNަqqq[YY☘yyyρIII񎍐jlm`_b578245VVVަvvv|zzb``ߒ~~~yyy\\\edgRTUa`b=?@jlm铓^^^ޥwwwsqqmkk܋xxx88:&()GIJjijOQR9;뗖ihjJLM/01xxyfffޥwww^\\}}}ðXXX]]_79:vx{feg¿ľBEGehhBDEޥwwwUUUwwwɶmmmkmn\^_=?@eginmoü?DE%)*GLMߥwwwNNNtttϲSSSGIJ\^_OQRXZ[~}͊?DE156imnߥwwwFFFoooШCCC󗙚!#$:<=fhiJLMވ􄊓LNO{}~ehinqrgij59:?BCߥwww===kkk˜NNN憈689JLMLNOoqrtvwWYZ랝mmokpy]]_Z\]vxy79:džVXYCEFUVWߥwww888 hhhʙSSS䁃$&';=>LNOXZ[XZ[_abgfhӷ}gglabc&()?ABY[\̏OQREEEkmmߥwww444$$$gggҢAAAgfh--/acdϿ!#$<>?ȫwo{dkaNXZ[/12̏ȱZ[[ߥwww222)))iiiد@@@󺹻srt\[]͹npq"$%')*ompǘ¶xhʸ˼dZZ\&&(춷RSSߥwww///...lllռfffeeeÆ܄CEFsuwⳲնvvwŽnʠí`^`aacő]]]OOOߥwww---444oooɟQQQuwxqstbdeݍ۱܍SSSOOO}}}Αz˸rfegtsu877]^^ߥwww+++888pppPPP___򃆇_abyxzvtwڠuuuAAALLKߣ~ֲ̞tvuvxwy=<<ߥwww$$$>>>񲲲www~~~JJJabb`fgjnoSSVlor١ffhBCGOQSüsᷭ}}}_^_hghߦxxxEEEꪪ}}}վXXX333kkj睠V^]]gd򁃅/25#%'}{yهHKP46}QVU@ߦxxxiii%%%aaaԘ׈@@@|||9<=./1BMHO_X);8"))~%'*moq_^`XWYߦxxxbbb***jjj͓]]]DDDpqr)+,BADeoj2B9鍧"3/9?>򴶶Y[\$&*36:lkmYXZߦxxxYYY///sssǎ毯\\\ZZZ򧩪IKL*,-ikl:IASj`ؿֿv*$FOK؎58<$cgk'&'srtߦxxxRRR222|||Š嘘@@@~~~Њ=@A356uxyUa[I_U~ۺӼӶϽZvi+#U_[RUZ79>_bczy|?>@ߦxxxJJJ444|||999]_`?CDQc]N{eéز˵̳̭ŶGbVrywz{WXX@?AߦxxxEEE444III>>>%(("$FSQ|۞ĴYM'?ODLUSAFENNOݦ{{{111<<<𣢤LKMbacQRNEEC툑EeXƯΕٱg^pŧ̓ѭ§Đέp`pbo&F0O[Xjss('WWW```ڤ{{{+++<<<񞝟=<>ꐙ$#LMNZ{k^|뾡跟ᵁ^tufz@^Nn|ʫv^t\g'61{t+33]hg___ۤyyy###>>>ߝKJLȶgusn{Vvت洛欜櫟䰏Φ`y>dT6QH/@;+%[oeYylbtȟ•ˤB]P*-6LKP$),QQQߨ|||BBB㉈ONPqprGFHIGIHFHFJK?MM6ABTPTkw﷊᥉ߝភ櫙ܱh+J?  W]\{><<<888555533111///--,)))%%&$###""! QPOܤzzz___mmmUUUĽ~~~gff^^^WVWŧj7sO"O(IWkƑfguϕI{W.>.kkhgde,D7RywjΏC]>WJ[YZrrrګ򶼿V`i*# 1&        1P(,BV%2 G"X1 #- [#U1j_थx|}ggg444XXX|||xxxtttqqqmmmhhheeeaaa]]]ZZZXXXSSSOOOKKKGGGCCC???===999454000,,,(((###$$$777'''999rrr|}|ܺf^:S?{IsÊm[bސb*V8blc񑑔0E;Mnaދfސ_-bGt|[[[縸t)$1^*O$&*P !N\3=Y$n2O"Dd,b5&Nh(<O?0㥣y{zppplll+++UUUSSSQQQMMMIIIEEEAAA???<<<::::::444---+++)))&&&###   """%%%)))111666===FFFRRR___```mmmך΍ΠaŠLuAYT`mXȆZЊj̎]tAbL1HDOd`|eوjڎBb9 DS)%")M W,C!CK2 !9 * "t}ᦣzzupppjjj!!! """&&&***---000444:::@@@GGGNNNTTTZZZ___bbbkkkppptttzzzʪlllܹhJt.}O*c;5`:4g<$l<5TLeRcA^UMl[ӀRyRzX{'p?Tf]㑑pop>F<6@' ?A5S+D>"KA Qb+) <A rۤv}unnn٠vvvppptttwwwzzzμdzY; F)21#2=25C4&<*; 45&^fdk|PySۅM{DqSy7RN[vwv8F8U"H 2=d-m-I' P Y$7u0;4 C"j3;  $z٥r|s]]]lvt'=5!:/?QJ_ffyy~nupM^R>FB==A^Ybnz8C107ouuںǽCfP"b6%i=5wR8^6eFyNzc~ﵯ=IJ.;4V.N N f2n5 Y0R*C  :r2s0\'C3J. )( {ݯ|xv888cccȩW^_0@Cþjkp%,*]d_ؤ⒒^^_>DE8HHBWT?TE0?3"0+1' D)!nFHnz@JI/3 ,+U'IF?(&4   a0q7X,>  :"J% +>!6,(ܮ~{{iii;;;xvv]ih~072y~|ߺ`gl'54/=ޢs{wŃbbbxxx提~-0:[^qĻlvBHW菇TVU򼾴ogYg6^' R# ]' DB$L.=%S6T0))&%1?>([F:I;?LH9UO=SFP\MVm\MpbIbaY]hlkgrux㦩x{väox~NXecmnw\duW]fvtv迿氰yohdXQf]Wkb[ngdrnivrkuuru~㨩z{yx*5@  RVVѸĶ¹ҥ٠gggOOORRRJJJAAACCCIIIMMMZZZ⻻R\k"#'ݯұgggzzzZZZ888???qqqgggUUUkkk[[Yepgoz瞜dccڵԑ555,,,666eeeʸnnn\\\jjj[\^hec՞}p{ONMpoq㻻΃111222눈{{{ѕBBBBBB䨰U[a__aʺkrbnYgO\w=I\/9BUZ_򟟟^]^ww{ѵ͛PPPZZZFFFBBBޗ6@N#)2lrt`dhLOT-17&(5Zby‹iz\iHTi !FIL{}~}~GP^佽٭yyy}}}rrr}}}}!0_dl奪tu|PRXBEMM"34DdT^poqt迿 VVV [[[***􆈈ghj녅RVg݅O^v3@[KZyxDL`QZp{MWiww{mmm999aaa 222___---򜜜SSSrrr󒔔wxyOUdIQcSSSiii{{{888@@@ SSS[[[lll񡡡vvv rrr///'''777VVVėU[jSYl񅅅((( ```EEEBBB%%%yyy555DDDSSS 555|||\bpioş lllZZZjjj SSSmmm000JJJ>>>TTT333UUUhhh숋y聏NNN@@@pppKKKvvv WWWGGG999fff444uuujjj...qst쬰vwvx󔔔444BBB LLL555999~~~"""888***{{{ݓࢫޅmlnccc蛛AAA/// PPP888TTT=== +++kkkyz{ʜ槺٨ڧ٧٩ګݰ᰿ޮݭܬުǢˆ333...eeeXXXnnnhhhSSS___fff222ccc&&&SSSVVV]_`ǎ[\^rrtꪽؤҚɔ’ěʡФҤӨժ֩֩֨ԣМəŚǟʤѦߴؒ`\ZXTSNNNLKMwux`_aiii ---ZZZSSSUUUYYYEEE"""444fffzzzggg\\\rrr888FFFɋTTT...000IIIXXXCCC9;?oqr{~~ﭷ͏㩷ݨݩޫ౿POQvuwQPROOO%%%...ggg䌌jjj}}}QQQAAAWWWeeeLLLYYYJJJ***,,,%'( ruu=Mb樴ڦ٥ףը۱㍔_^`VUW@?A&&&򆆆444qqqPPP<<<\\\$$$444***eeeyyy7?H+2=W_ot|15?*)++*+,,,[[[www 뗗PPPxxxxxxkkkNNNJJJ^^]!!!AAAMOQ}|z00/HHO^bnMTdbl˰쫸ؒv\cwADO338JIKJJJ+++$$$fffÔsssYYYYYYjjjtttjjjgggiiiuuuZZZ222???PPPJKJVVVㆆ+++012TQOnlnlnuMP]MRaV_m\fuhrxʣҰ۽޿ڸر۸۾طְѩ¡q}ft`lYbplq~adnDEJnmn~$#$ppp sssGGGԘVVV444NNNLLLLLLLLLVVV```aaayyywww҂}}zz{𿾿cacNMN><=5192245@4LI1@L59;:?>GRT^hjӵZYYਨaaaxxx٠hhhZY[IHISRSPPPAAARQR`_a}|~~nuf]d_UUXRNROJSBBQ;DD?JAHMLFQJTYPb_`[beYd\XhjlxǼOONOOOKKKrrr666~~~<;;~546}DCEƼ``a녅```&&&𜜝ECE獌TSTYXZi`x삝qqqbbbBBC⥦PPQ拊NMO#<);dllldddiii JIK^^^###^^^UUVEDGb9,>4^:bQqԻiiiWWW;;;ooouuu~|{}jjjpppwww|{|sssrqsyxzXuBj!U>69 7= ??c^^^XXXwwwlllPPPTTT!!!㉉nnnPOQ5\'8<4 3%N^Ձॺiii***888卌`_a```*)*###XXX}xxxlkmh5^IrZO"/Jr***DDDlll(((436}}} @@@NNNKJK9f:edddxxxhhiUUVܣgghkjkoޔ½ǻDDD BBB}}}|||ZZZ PPPiiiPPQOPQʴfffJJJ///  ///333000000111111444111  uuuMMMQPPQPQQQR˺popCEFCEGtuwgggGGGJJJRRRYYY[[[[[[[[[[[[[[[[[[YYYUUUMMMLLLJJJEEECCCKKKLLLLLLLLLNNNUUUXXX[[[[[[\\\VVVWWW҄RQS=<>?>?TSU޵vvvccdTTTIII=>A=?EPQWnps޼zzzsssllleee___]]]]]\__bopt(3  !#%%%&&&%%%&&%%%&%&%%%&~%{%v%u%v%t&s%s%r%o%l&j&h%e%e%d&c%b&a&^%[&Y&X~%X{$Tz%Sz%Ry&Ox&Nw%Mv%Jt%Is&Is%Fq%Dq$Bp$Co$?m#;l!:k7i5g3e2d/a+`)^']#[!X WVWWVUSSSSRRRRRQQQQQQQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN I))a$ ||zywxwtsomljighfea_^][[XW}T|QyQyPxNtMtKtHsFrEqDp@m?k>j:h7g8f4d/b-a*_(]'[ %Z #Y WURQOLKJK K J I G G G GFFFFFEEEEEEEBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVQ%  """###"""#$#"$~#}$}#z#y"z"x#u$u#q"n"n$k#j"i"h"g"g#d#b"`"^"]#\#Z$Y#Y}#W|$V{$Uz$Sz#Qy#Nw#Jv#Jt!Hs DqBm?l=j9h7g6f1d-a+`(^&\%[ $Z !XUTQPNKJJ K KJ I G G G GFFFFFEEEEEEEBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV   "#$&(***+++***+++*++++}+|*{*z+x+v*t+r*p+o+n+n*k*j+i+g+e+d*b*a+_+_+^+]+Z+X}*V|)T|(R{%Oy%Lw$Kv"Gs CoAl=k;j8j8h5f0c,b*`(]&\%[ $Z WUTROMJJJK KJ H G G G GFFFFEEEEEEEEBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV  !#%&')*+-/01222221122212222~2}1z1z2{2y1u2t1q2r2q2q1n2m3m3j3i2h2g2e2c2a0_._.\-Y~+W})R{(Pz&Nx$Kv"Iu!Eq Bm@ll?@AABAA@ABBAAABA@A@@AA}AzByAwAwAv@u@u>r=o=l;j9h6e4c3a2`0^/Z-W+S~+Q|)Oy&Mv%Kv$Gs"Fq!Cn ?l=l@ABDFGHIIJIIHIJJIIIJIIIHIHHH}G|FzEwDvBu@s>p?ACDEGHIKMNOPPQPPOPQQPPPPPOONNMKI{GwEuDsBqAp@p>o@BDEFHJKLNOPRTUVWWXWWWWWWWVUTTRQNLL}J|HyGvEtDrBpAo@n>kifcl";l!:l 8j5h2g0e-b*a)^']%\#[ YXW U TQOONM KJJI G GFFF0 (&&&%'EEEEBBBBBBBBBBB?&#$=BBA/ #("& &!'"&!&!&!&!&!&!BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV+*~~}}~~||}}|}}|}}|zyz{yyxwwxxyxyyvwxwwstvvtrssssssrsstttsrrrrrsrqqrrrsvu t v xy|||}~ !"#%&)**,./134579:<<>ABCDFGIJKMOQRTUWXY[\^acddfghhhhiihhfedb`_][ZYWVTS|Q|P{N{LxLuJsHpFoElCiBhAf?d=b<`?e;`7Y6X4W3T~1S~0O|/Kz-Iw,Hv*Ft(Dr'Bq%@o$=l";l!:l 8j5h1g0e-b*`)]']%\#[ YXW U TQOONM KJJI G GFE0 (#'"% % % '"$EEED:&?BBBBBB? #)$ 5BA3$'"'"&!&!&!&!(#*% *%*% *% )$BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVda~~}~~}}}||}{{z{|yyyyxxxxxxxwwwwwwvvuuutssstpnooonooprrqpqqqqqqppppprqqrs t u vwxxz{}~~}~ !"$%()*+-.1224679;<=?ABDDFIJKLNOQRSUWYZ\]_`acffghhhhhiihhhhhgfecb`_][ZYWVT~S|Q{PzNwMuKrIpHmFkEjCgBfAf>c@f:\)9*Db@BCDFHIKKMPQRSUVXYZ\^`bddfgghhiiihhhhhhhhhhhgfecb`_][ZYWV~T{S{QyOwNtMrKpInHlFhEgCeBdAd?b@d:\"4M.Hj;]5V4V~3R}1O|0Lz/Jy-Hv,Et*Ds(Aq'>n%=n$o%=n$:m"8k!7k5i2g/d.b,`*_'^#\![ ZXWW T QPOON L KJI GGGFFF5 *% )#("%!&!& &!&!*%" (#(#&!$@BBBBBB@&&!&!&!)$ *% '"%!%!&!&! " 9BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV vutussrsussssrssqqpllljkkjjiiihhffhiihhihhhihgcaabbaba```bcc e g iiiklnoqqpstt u!v#v&w'x(x)z+{-{/|0|1}24678:;>?@ACDGHHJLMOQRSUWXZZ\_`abdffggiiiihhhhhhhhhhhhhhhhhhhhhgfecb`_][Z~Y|W{VyTxSuQtOsNpMnKlIkHiFfEdCbBaA`?^>[p'=o%;m$8l"7l!6j 2h0f/b.b+`)_&^#\!Z YXWV S QPOO N K KJ I GGGFFFE-&!&!&!&!("&!&!)$)$% &!'"$@BBBBBB>''"&!&!&!&!% % &!&!&! 3BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVussrrqooooommnmnnllliiijihhhfgeeeccddcddeeedddc`^^^_]]__^ _ b ccegghiihilop!o$r&t&s't(u*v-w.x/x0y2{4}6}7}8}9~;=>?ABEFGHJKNOOQSTVXYZ\^_aacfgghiiiihhhhhhhhhhhhhhhhhhhhhhhhhhgfecb`_]~[}Z|YzVwUuTtRqQpPoNlMjKkIiHfFdEcC`B_A^?\=Y;W;U9S7Q~5O}4N{3Lz1Ix0Hx/Gv-Cs,Ar*@q(=p';o%:m$8l"7k!4i 1f1d-a+a*`'^%]"[ ZYXUS R QPQO M L JH GGGFFFEEE $#$ ! &!% &!&!%!% & #@BBBBBB8 )#&!&!% % % &!&!&!'" 4BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVppoonnnnmmjjjiihhgfgifhgeedddcccbbbba```__b`_][[\] ^ ` ` `abdeffgggiij k#m$n%p&p(q+s-t-u.v/v1x4x5y6y7{9~;=>?~@BDEFHILMNOQRUVVXZ[^_`acefgiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhgfecb_^~]}[zYyXwWtUsTsRpQpPnNlMkKkIhHdFbEbC_B^A\?Z=Y;V;T9S7P~5M|4Kz3Jy1Hy0Gw/Et-Bs,Ar*>q(~@BDEFGIKLMOPSTUVXY\]]_abefghiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhgedca_~^}]|[{YyXvWuUsTsRpQoPmNlMjKiIgHdFbEbC`A]@[?Z=Y;V;T9R7O~5M|4Kz3Jy1Hx0Fv/Et-As,?r*=q(;o':n%9l$6k"4j!3h0e/c,b)`&_%]$\"[ YVUTS R RQPO M I H G GGFFEEEEEEEEEEEE9)$ % &!&!&!&!&!$@BBBBB<)#&!&!% &!&!&!&!'"&!% &!&!$-+);BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV.O kjiijjihhhhhfggeedca`_^aa__a`_]]][[\[\]]_ ` ` ` abb`bcdeggff g"h$j$k&j(k*m+o-o-o.o1q2q3r4r6t9u;u;vr*>>,,/..3BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVe\Igfeffhggfeedcdbbaaa]\\Z\[YZYZ[YZXYY\ ^ ^ `aabcccedcdef!h"h#h#g%h'i)j+k+l-k/l1o2o4p4q5p8r9s:t;t=u@wBxBxCwDxFyI{J|K}LNPRSTUWYZ[]^acdefghiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhggggggggggggedc}az_z^x]w[wYvXtWqUpToRmQmPjMgKfKeIbG_F]D[CZAY@X?V=U;R;O9M}7L{5Ky4Iw3Fv1Fv0Cu/Bt-?r,>p*;p(9n&7l$5k#3h"2f!1e/c,b)a(`&^$]#\ ZXWVUU S QQPM J HHGFFFFEEEEEEEEEEEE FBA@$$&!&!&!% #@BBB=& AA?RVVQUURTTQSTQSTRTTRTSQSSRTTQSTRTTQTTQTTRVUMPOLNN?ABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVPdcbccaaabaa```__]\\Z[YYXXWXWXXXY Y Z ]`a`bbccddde d!c#e%f&g)g*h+i+h-i/k1j3l3m5n7o9p:qq@qAsCtCtDtGvHxIxJwLyO{Q}Q}R}S~UXYZ[]_abdefhhihhiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhggggggggggggggggggggggge~d}c{aw_v^v\tZqYoXnVlUkSjRjPfOdMcKaKaI`G[FYDWCUAR@S?R=P~;N|;N{9Lz7Jy5Hx4Fw3Du1Cv0At.@r,=q*9o*7m(6l&3k$2h#1f"/e!.d,c*a'`'_&^#] \YWWVUT Q PML L K IGFFFFEEEEEEEEEEECCB2/+% &!&!&!&!&!#?BB;;=?>;BA?QRSTXXPSSQSSPRRPRRQSSPRRQSRQSRQSRPRRQSRPSRPRRQSSPSRPSRSUUCCDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV___^^]\\[ZYYYYXXWWWWWY Y Y ZZ[[\]_^^`aa `!b"b#c&e'e(e*f*g-h.f/f1h3i4j7l8l9l9l;m=n?pAqAqCsEtGtHvJwJwKwNyOzP{Q}S~VXXZ[]`abcefghhhiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhggggggggggggggggggggg~g~g}g~g}g~f}e|dzbxav_t^s\rZpYnXkVjUiSgRePbOaM^K]K]I[GXFWDUCTAR@S?Q~=P};M};K|9Jz6Gx5Fw3Dv2Bu1@t/?t.?SUTPRRSUUHHF!#'"&!% &!#?BCORUTWVUWWRTTPRRPRRQSSPRRQSSQRSQRSQSRQSRQSRPRRQSRPSRQSSQSSPSRPSRSUUCCDBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV]__^^]ZZYYXXXXXYY Y Y [\\]]__^_``a b!c"c$c&c(c)d*d+e.f/g0g2h2h5j6k7k9m;ns.;q,8o*6n*5l(4j&3i$2g#0f".d!,c)b(a'`%_"\ Z YYXWURQ P ONM K J HHGGGFFFFFFFEE(%"653RUTPRRQSSKML51/85440-$!"$"?BCLNRPRRQSRQSSPRRPRRQSQPRRQSRPRRQSSPSSPSQPRQPRRPRRPRRQSSQSSPRRPRRSVUACCBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV]]\\[[ZZ[[[[ \ [ \^^^^_b`a`bcb!c"c$d&e'e(f)e+e-g/h0h1i2j5k6k7l9k9kp@rBsCsFuGuHuHuJxLzNzPzPzR|T~V}W~YYZ]_acdeggghiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhgggggggggggggggggg~g}g~g}g~g~g}g}g}g|g|g{g|g|g|fzeydwbtas_r^q\oZmYkXjVhUgSdRcP`O`M]K[K[IYGVFVDSCSBR@Q>O~=N};L|9Jz8Hy7Gx5Ew3Bv2@u1?t/=s.;q,8n*6k*5k(4j&3i$1g#0f"-d!*c)b(a'`%_"\ ZYYWVTRQ P ONM K J HGGGGFFFFFFFE,)&$;97RTTPSRPRRQSSUXXW[[OQP20-0,)41./-)CB?NPUQSSPRRPSRQSSQSSPRRQSSPRQQSSPSRPRRPRRPRRPSSQSRPRQPRRPRRPRRQSSSUUFHIBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV[ZYY[\\ ] ] ]^_^_aa`aabd c!d"d$e%e'f)f*f,g.h/h0g1i3i5k7l8k9l:m=n>n?oApAqDqEsFuHuJvKvNxOwPwPxRzT{V|X}X}Z\^_aabdfhhiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhggggggggggg~g~g~gggg~g~g~g~g}g}g}g|g|g{g|g|g{g{g|g{g|g{g{g{gzfyewdtbqaq_o^m\lZlYjXgVfUeScRbP_O_M\KZKZIXGVEVDSBQAQ@O>N~=L|;J{9H{8Gy7Ex5Cw3@v2@u1>t/p?o@oApDrErFsHtHuKuLwMxOyQyRyU{V{W|W}Y}[~]__aceffghiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhg~ggggggg~g~g~g~g~g~g~g~g~g~g~g~g~g~g}g}g}g}g}g|g|g|gzg{g{gygygzg{g|gzg{gygygxgxfwevdtbqap_m^k\jZjYhXfVeUdSbRaP_N^M\L[JYHWGUETDRBQAP@N~>J}=I};H{9Fy8Fy7Dx5Av3?u2?u1=s/;q.9q,8m*7k*6k(3i&0h$.f#,e"+d!)c(b(a&`$^![ZZYWTSRQ P ONN L J HGGGGGFFFFFFF;:720-QSSQTTPSRPRRQSSQSSPRQQSSQSSPSRPRRPSRTWVPRRPSR'"MNMSUUPRQQSSPSRPRRPRQQSSQSSPRRPSRPRRPRRPSRQSSPRQPRRPRQPRQPRQPSSNPPMNOBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV ^__``aabccec!e"f#e%f'f(g)h+h,h.h0i1i2i4j6l7l8l:nJ|=I{;G{9Ey8Dy7Cx5Av3?u2>t1=s/p@qAqBqCrErGtIuJuKtLvNvQwQwRxTzVzW{X|Z|\~]`aacdgiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhg~g~g~g}g|g{g{g|g|g{gzg{g{g{g|g|g|g|g|g|g|g|g|g|g|g|g|g|g|g{g{g|g|gzgygygygzgygxgwgvgvgvgwgvgugugtfsfsftfufsftdscpbo`m^l]k\iZhXfWcVbT`S_Q]P[OZMZLYJXHUGSEQDPBNAM@L~>J|=I|;G{9Ey8Cy7Bv5Au3?t2=r1

H|=G|;Fz9Cx8Bw7Bv5@u3=r2;q1;p/:o.7m,4l*1k*1i(/h&-g$-f#*e"(d!'c%b$_"^!]\[YVUUSRQ P OML K J HGGGGGFFFFFF986RTTRTSPRSQSSPSRQSSPSRQSSPRRPRRPSSPRRPRRQSSQSSRSSHIH'"NPORUVPRRPRRPRRQSSPRRPRQPSRPSRPRRPRRPRRPRRQSSQSRPRRPSRPRRPRQVXY7532/-BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV{9[\]]^^^_^` _"a$a%a&b(b*c+d,d.f0h1h3i4i6j8j8j:lH|=G{;Ez9Cx8Cw7Av5@t3=q2;q1:p/8o.5n,3l*2j*1i(/h%-f$.f#+e!'c!'c%a$_"^ ]\ZYVUUSRQ P OLK J J HGGGGFFFFFFF42/QTSRTSQSSQSSQSSQSSPRRPRRPSRQSSQSSPRRPSSPSRPRQQSRVYZ&!MOOTWVQSRQSSPRRPRRQSSPRRQSSPRRQSSPSRPRRPRRQSSPSRPRQPSRPRQPRQVXY75220.BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVd[\\]]]^^]_ ^"^$`%a&a(b*b+c,c.e/d1e2e4g6h8h8h:jH|=Fz;Dx9Cw8Cw7@u4G|t4:r3:q29p07o/5m.4l,1k+0j).h',g&+f$)f#&d!'c!'c%a#` ^]\YWVUUSQ P O N L K J JHGGGGGFFFFFF530SUUQSSQSSQSSPRRPSSPRRQSSQSSQSSPSRPRRPRRQSSQSSPRR"& OQPRVVPRQPRQPRQQSSPSRQSSPRQPRRPSRQSSQRSQRRPSRQSSQSSPRQQSSQSSVYY975'$"BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVLXXXZXXXY\\] \"^$]%^&](_*_+`,_.a/b1b2b4b6b8b8d:dEzDxBx<@x:>v:>t8;s69r47q36o24n04n/2m.1k,-k++j)*h'(g&'f$&e#$c!"b !a`_][YXWUTSRR P O N L K J JHGGGFFFFFFFMNNUWXQSSQSSQSSPSRPRRQSSPRRPSRQSSPRRPSRQSSQSRPRRQTTRTT&!&!NPPSUVPRRQSSPRRQSSQSSPRRQSSQSRQSRQSSQSSQSSQSSPRRQSSQSSQSSPRRTXWAA?("BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVSTTUVVUVWW X!W$Z%[&[(\*]+[,[.\/\1^2^4_5^6`8a:a;b=d?e@eAeBeEgFhGgHhJgLiNiOjPlRlSmUnVoWpYr[s]t^u_vaxbxdze|g|h|g{g{gzgzgzgzgzgygygygygxgxgxgwgvgvgvgugtgtgtgtgrgrgsgtgtgsgsgsgrgsgsgrgrgqgpgqgpgpgpgpgpgogogogofnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfmfmfmfnfnfmfnfnfnfofnfmflflfkfkfkfkfkfkflflflflflflejdichaf`d^b]c[aY_X^W]UZTYRWQUOTNSLRJQJOHMFK~EJ}CG|BF{@Dz?Cy>By<@v:?u:=u89s67r45p34o22n03n/1m./k,-k+*j))h''g&&f$%d#$c!"b !a`^\ZYWVUTSRR P O N L K J JHGFFFFFFFFF420TVWRTTPRRPRQPRSPSSPRRPRRPRQQSSQSSPRRQSSPRRQSSQTSJKJ&!&!NPOSVVPSRQSSPRRQSSPRRPRQPRQPSRPRQPSQQSSQSSQSSPRRQSQPRRPRRPRRPRRVZZDDB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVoASTTUUVUVXW X!W$Z%[&[(\*\+[,[.\/]1^2^4^5^6`8a:b;b=d>d@eAeBfDfFgHhIhJgKhNiOjPlRlSlUnVpWpYp[r]t^s_uawbxcxezf{g{gzgzgygygygygxgxgygygxgxgvgvgvgvgvgugugtgtgtgrgrgsgtgtgtgsgsgsgrgrgsgrgrgrgpgpgqgpgpgognfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfnfmflflfnflfmfnfmfmfmflflfkfkfkfkfkfkfkfkflflflflflflejdichaf`e^c]c[aY_X^W]UZTYRWQUOTMRLQKPINHMFJ~EI}CG|BF{@Dz?Cy>By<@v:?u:=u89s67r45p34o22n02n/1m./k,,k++j))h''g&&e$%d#$c!"b !a`^\ZYWVUTSRR P O N L K J JHFFFFFFFFFF641SUUQSSPRRPSSPSSPRRPRRPRRPRRPRRPSRPRQQSRQSSSWWOPQ%&!'!NPOSVVPSSQSSPRRPRRPRRQSSPRRQSSQSSQSSQSSPSRPSRQSSPRRPRRPRRPRQPSRPSSVXX232BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV'SSTTUTVVWW W!W#Y$Z&Z(Y*Y+[,[.[/\1\2]4^5_6a8c:d;c=b>c@dAeBeDeEfGgIfJgKgMgOiPkRlSmUnVnWnYp[q]r^s_tavbwcyeyfzgzgygygxgwgxgxgwgxgxgwgwgvgvgvgvgugugugtgtgsgrgrgsgtgsgsgrgrgrgrgrgrgqgqgpgpfofofnfnfnfnfnfnfmfnfnfnfnfnfnfnfnfmfnfmfmfmfnfnfmfmfmflflfkflflflfmfmflflfkfkfkfkfkfkfkfkfkflflflflflfkfkfkejdichaf`d]c\b[aY^X]W\TYSWRVPTOSNRLQJPJMHKFJ~EI}CG|BF{@Dz?Cy>Bw<@v:=v::t89s67r45p34o22n02n/1m.-k,,k++j))h''g&&e$%d#$c!"b !a _ ]\ZYWVUTSRR P O N L K J IGFFFFFFFFFF2/-SUVQSSQSSQSRPRQPRRQSSPSSQSSPRQPRRPRQPSRPSRSVVOQQ'!&!'!NPOSVVPSRPSRPRRPSSQSSQSSQSSPRRPSRPRRQRSQSSQSQPRQPRRPSRQSSQSSQSSQSSQSSNPPBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVJQRRTUUUUVV V!W#W$V&X(X*X+Y,Z.[/Z1[2]4^5_6a8a:b;a=b>b@dAcBdDdEdGdIeJfKgNiOiPjRlSmUnVnWnYp[p]r^t_uaubvcxeyfxgxgxgwgwgxgxgxgxgxgvgvgvgvgvgvgvgugugtgsgsgrgsgtgtgsgsgrgrgrgrgrgrfpfofofofofnfnfnfnfnfnfnfmfnfnfmfnfnfnfnfnfnfmfkfkfmfmfmflflflflfkfjfkflflflfkfkfkfkfkfkfkfkfkfkfkfkfkfkflfkflflfkfkfjeichbfae_d]d\a[_Y]W\V[UXSWRVPTOSNRLOJNJMHKFH~EF}CD|BC{@Bz?Ay>@w<=v:;v:;u89s67q45p34o22n02n//m.-k,,k++j))h''g&&e$%d#$c!"b !a ^!\\ZXWVUTSRR P O N M K I IGFFFFFFFFF;980-)SVVQSSPRQPRRPRRQSSQSSQSSPRQPRRPSSQRSPRRPSRRUVNPO'!& $MOPSVVPRRPRRPSRPRQPRRQSSQSSPSRPRQPSRPSSPRRPSRPRQQSSQSSPSRQSSPRRPRRPSSPRSBBBBBBBBBBBBBBBBBBABBBBBBBBBBBBBBBVBQQRSTSTUVU W!W#W$U&V(X)X+X,X-Y/Z1[2^3_5^6^8_:_;`=a>b@cAbBcDdEdGcIeJeKfMgOhPjRlRlUlVlWmXmZo]r^s_tatbvcwevfwgwgxgxgxgxgxgwgvgvgvgvgvgvgvgvgtgtgtgsgrgsgtgsgsgsgrgrgrfpfqfqfpfpfofofofofnfnfnfnfnfnfmfmflfmfmfmfnflflflflflfkflflflflflfkfkfkfkfjfjflflfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfkfieieieieieieicgbfad_b]c\`[_Y]W[VZUYSWRVPTORMQLOKNIMHKFG~DE|CD|BC{@Az?@y>?w<=v:;u:;u89s67q45p34o22n00n//m..k,,k++j))h''g&&e$%d#$c!"b !a ^!\\ZXWVUTSRR P N L K J I IGFFFFFFFFCSVVHIIQSSQRSPSRPSRPRRQSSPRRQSSPRRPRQQSSQSSQSSQSSSVVNQO&!% GGFQSTQSSPRQPRQPRQQSSPRRPRQQSSPSSQSSQSSQSSQSQPRRQSSPRRQSSPSSQSSPRRQRRQSSORSBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBV~XQQQSSRSTTU V!U#V$U&V(X)X+W,X-X/Z0]2]3\5]6^8^:_;_=a>a@bAbBdDcEbGbIdJeKgMgOiPjQkSlTlVlXlXmZp\q]r_t`satcudufvgxgxgxgxgxgwgvgvgvgtgugvgvgvgtgtgsgrgrgrgsgsgsfrfrfqfpfqfpfofofofofofofnfnfnfnfnfnfnfmflflflflfkfkflfkfkfkfjfjflflflfkfkfkfkfkfkfjfkflfkfkfkfkfkfkfkfkfkfkfkfkfjfjeieheheheieheheheieieiehcebdac_b]b\`[_Y]W[VZUYSWRTPRORNQLOKMIKGI~FG~DE|CD|BC{@By?@y>>w<`@aAbBbDaEaGbIcJeKgMgOiPiQjSkTkVkXlXnZp\q]s_s`sasctdufwgxgxgxgxgxgvgvgvgugtgugtgsgsgrgrgrfrfrfrfrfrfrfqfqfqfpfofofofofofnfnfnfnfnfnfnfnfmfnflfkflfkfkfkfkfkfkfjfjfjfjfkfkfkfjfkfkfkfkfkfjfjfkfkfkfkfkfkfkfkfkfjejejeiehehegegefeeefefegegefefefeeccbcad_c]b\`[_Y]W[VZUWSURSPQOQNPLNKLIJGH~FF~DD|CC|BBzAAy??x==w<_@aAaB`DaEbGbIdJeKgMgOiPiQjSiTjVkXlXnZp\q]r_r`rascudvfwgxgxgxgwgvgvgvgugtgtgugtfqfrfrfqfqfrfrfrfrfqfpfqfpfofofofofofnfnfnfnfnfnfnfnfnfnflflfkfkfkfkfkfkfkfkfjfjfjfkfkfkfjfififjfjfjfjfjfjfkfkfkfkfkejejejeieieiehehefefefefefefeeeeeeeeeeeeeeeeeecdbeae_b]a\`[_Y\WZVXUUSTRSPROPNNLMKLIJGG~FF~DD|CC{AAy@@y??x==w<_@`A`B_DaEbGbIdJeKgMgOiPhQhShTjVkXlXmZo\o]p_r`sasctdvfwgxgxgwgvgvgvgugtgtgsgsgrfqfrfrfrfrfqfqfrfqfpfofofpfofofofofofnfnfnfnfnfnfnfmfmfmfkfkfkfkfkfkfkfkfjfjfjfjfkfkfkfififififjfjfjfjfjfkfkfjfjfjfiehehehegeheiehegeeeeeeeeeeeeeeeeeeeeeeeeeeeeeecfbfae_c]b\_[]YZWXVWUVSTRSPQOPNNLMKLIJGG~FF~DD|CC{AAy@@y??x==x<_?^A`B`DaEaGbIdJeKfMgOgPgPgRhTjVjXkXmZn\o]q_q`rarctdvfwgxgwgvgugugugtfsfrfrfrfrfrfrfrfrfqfpfpfpfofofnfnfofofofofofofnfnfnfnfmfmfmflflflfkfkfkfkfkfkfjfkfjfjfkfkfkfkfkfififjfjfjfjfjfjfjfjfiehehehegegehehegegegefefeeeeeeeeeeeeeeeeeeeeeeeeeeeedecfbead_b]`\][ZYZWYVWUVSTRRPPOPNMLLKKIIGG~FF}DD{CC{AAy@@y??y==v<^?]A_B_D`EaFaGcIdKeMeNfOgQgRhTjUjVjXlZm[n^p_o_parctdufwgwfufuftfsfsfsfsfrfrfsfrfrfrfrfqfpfpfpfofofofnfofofofofofnfnfnfmfnfnflflfkflfkfkfkfkfkfkfkfjfjfjfkfkfkfkfjfjfjfhfhfifjfjeheheiehefefegefeeeeefefefefefefeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeddccbbaa__]]\\[[YYWXVWUTSSRRPPOONNLLKKIIGG~FF}DD{CC{AAy@@y??w==v<=X\\PQRQSSPSRPRRPRRPRRQSSPSRQSSPRQQSSQSSQSSQSSQTSRUTGIG% -)&ORRRTTQSSPRRPRSQSSPRQQSSPRQPSRPSSPRRPRRPRRPRRPSRPRRPRRPRRQSSPRRPSRQSRQSRRTT122BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVMOPOPPPPPP Q!R#R$S&S(S)U+V,W-V/W0X2W3X5Z7\7\9[;\<\>^?]A^B^D`EbFbGbIcKdMdNeOfQfRhTjUjViXkZm\o]n^n`parbtdtevfvftftfsfsfsfsfrfsfrfrfrfrfrfqfpfpfpfofofofofnfofofofnfnfmfmfmfmfmflflfkfjfjfkfjfkfkfkfkfkfjfjfkfkfkfjfifhfhfhefefefeheiegegegegefefefeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeefegegegeeeeeddccbb``__]]\\ZZYYXXUUTTSSRRPPOONNKKJJIIGG}FF}DD{CC{BAxB@w@?v?=u=\?]A^B^D_E`FbGaIbKdMdNdOeQfRhTiUhViXkZm\l]m^p`qaqbrdteufuftfsfsfrfrfrfsfrfrfrfrfrfqfpfpfofofofofofnfnfofofnfnfmfmfmflflflfkfkfkfjfjfjfjfkfkfjfififjfjfjfjehehefeeeeeeeeeeefefefefefeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeefegegegegegegegegeeeeeeeddccbb``__]]\\ZZXXWWVVTTSSQQPPNNMMLLKKIIGG}GF|EDzDCyBAwB@w@?v?=u=\?]A^B^D_E`FbGaIbKbMcNdOdQfRgThUiVjXlZk\l]n^o`qarbrdsetftfsfsfrfsfsfsfrfrfqfrfqfpfpfofofofofofofnfnfofnfnfmfmfmflflflfkfkfjfjfjfjfjfkfjfjfjfhffffeheieiegegeeeeeeeeeeeeefefefeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeefegegegefefegegegegegegefeeeeeeeddccbb```_^]]\[ZYXWWVVTTSSQQPPONNMLK~KJJI~HG|GF|EDzDCyBAwB@w@?v>=t=;s;9q98p97p86n74m52k41j30i3/i/.h++f))e))d''c%%b##`""`!!_]]][YXWUTSRQQ O N M KJIHFEEEEEEEORRPRRQSSPRRQSSPSRPSRPSRPSRPRRQSSPRQQSRQSSPSSQSSPRRTWWLON&!% PRRPSRQSSQSSQSSQSSPRRPSRPSSPRQPSRPRRPSRQSSQSSPRRPRRQSRPRRPSRPRRPRRPRRPRQPRQPRRPSRSVUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVNNNOOOOONP Q!Q"Q$S&S'R(T*U+U-V.V0V1V3X4Y6[8[9[;\<\>]?]A_B^D_E`FbHbIaJbLbNcOfQgRhThUhVjWjYl\o]n^n`p`rbrcseufufsfsfrfsfsfsfrfrfrfrfqfpfpfofofofofofofnfnfnfnfnfnfmfmfmflflflfkfkfjfjfjfjeieieiehegeheieieieheieiegegefeeeeeeeeeeefeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeefeeeeeeefefefefegegegegegeeeeeddbbaa```_^]]\[ZYXWWVVTTSSQQPPONNMLKJIJI}HG|FE{ED{CByBAx@?v?>v==t<;s;9r99p77o75n53m42k31k53l96n87o33k..h--g**e''c$$a""`!!_]]][YXWUTTSRR O N M KJIHFEEEEEEE642WYZPRRPRQPRRPSRPRRPRRPSRQSSPSRQSSPRQPRRPRQPRRUWXLLL-)&#"QSSPRQPRRPRRPSRPRRPRRQSSPRRPSRPRRPRRQSSPSRPSRPRRPRRPSRPRRQSSQSSPRQQSRQSSPRRSUUCBABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBVMOPPOPPQPQR!Q#S$T%S'S)T*V+U-W.V0X1W3Y4Z6Z8\9\:]<]=^?^@]A_C_DaFbHcIbJcLcNdOeQgQiSiUiWjWlYm[n\p^o_p`qbrctevfvfuftfsftfufsfsfsfsfsfsfrfrfqfpfqfpfpfpfofofnfofofofnfnfmfnfnflflejejejejeieheheieieieieieieieieieieieiehegegegegefegefefefegegefefeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeedfdfddddedebbaa``__]]\\ZZXXWWVVTUSTQRPPNNMMKKIIII~GG}EE|DD|BB{AAy??w>>x==w<;u;9s:9s87q65p43n32m21l2/j0/j0.i-,h+*g+*f))e''e%%c$$b##a _ ^]\ZYXVTUUSS Q O N LKJIHGGGGFF30;/,(W[\OQQQSSQSRPRQQSSQSSPRRPSSQSSPRRPSRQSRPRQPRRVXXIKI#& DDCQSSQSRQSSQSRPRRPRRPRQQSRPSQQSSPRRPRRPRRQSRQSSQSSPRRQSSPRRQSSPSSQSSPRRPRRQSRSUV?>< CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCWFNPQPQQRSRTS!T#T$U%T'U)U*V+V-X.Z0Z1Z3Z4[5Z7[9]:]<]=^?_@^A_C_DaFbHbIdJcLeNeOfPfRhSjUjWkWmYn[o\q^p_q`rbsctevfwfwfwfvfvfufufvftftftfsfsfsfsfsfrfqfqfqfpfofnfofofofofoemememememekekekekeieieheheheheiejejeieieieieieieieieiejejeheheieieieheheiehegefeeeeeeeeeeeeeeeeeeefefeeeededededededddddddddddedfccbb`a_`]^\^Z\XYWWVUSSRRQQPPNNLMKKJIHIGG~EE~DD}BB{AAz??y>>x==w;;v99t99s77r55q44p22o21n10l/.k.-j++i))i()h('e&%c##b""b!!b!!a_^][ZXWVVWUT S Q P NMLKIHHHH<>JKKI'!20-X]]PRRPRRQSSQSSQSSQSSQSSPRRPSSQTSUYXUXXUXXUXX[^_NON#&"X\[UXXUXXUXXUXXUXYUXXUWWUXWUXXVXYUXXUWXTWXUXXWYYRTTORQPRRPSRPSRPRRPRRQSSQSSPSRQST<<9"EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEYNPPRRRRSTTU!U#T$U%U'W)V*V+W-X.Z0\1[3\4\5\7\9]:]<_=`?a@`AaCaDcFcHbIdJeLfNgOgPhRhSkUlWlWnYo[q\q^r_s`tbtctevfwfwfwfwfwfwfwfvfvfvfuftfsfsfsfsfsfsfrfrfrfrfqeoeoepepenemememememememelelelekekejejejejekekeieieieieieieieieiekekejejeieieieieieiehehehegegegegegegegefdedededfdfdfdfdedddedddddededddddebeac`b_a\_[^Z]X\VYUWTVRSQPOONNMMKKJJHIFGEE~CC}BB|AA{??y>>x==w;;v99t99s77r55r44r22o11o00n..l--l++j))h()h''f&%e#$c"#a!"` ``^]\\YXWWVUU T S R POONK77?...000-,,?BB2/-)$ MONX\\TWWTWVTXWUXXSUVPRSQSSPRQQSRMNN863751853852:7441. #842752752642642863;:8<;9;97<:8<:8;:7;:8;:8<:8;97LNLX\\TWWTWWUXXTWVUWVUWXUWXTWWSVVGIGGGFGGGGGGO LGGGGGGGGGGGGGGGGGGGGGGGGZ?PQQRSSSTTUV!V#V$W%U'U)V*W+W-X.X0[1\3\4\5]7^9]:^<`=a?b@aAbCcDdFcHcIdJeLfNhOiPjRjSjUmWoWpYq[q\r^s_t`tbvcwexfyfxfxfxfwfwfwfvfvfvfufuftfufsfsfsfrfqfqfqfqfrepeoepepeoeoenenemememememelemelemelelelelelekekekejejejejeieieieiejejekejejeieieieieheheiejejeieieieieiegdfdfdgdhdididgdgdhdgdgdgdfddddddddbdad`b_`\^[]Z[X[VZUXTXRVQSOPNPMNKLJJHHFGEGCEBD~AC}?B{>?z<=x;??ABCFGH555#40-GGF?>=@?>?>=??=<;9FGETWVTXVSTURTTJLK.+',)%*'#*'#,*&0-+0.,,*&,*'-*(-*'.+(-*&  530DDC??=??=@?=??=@?=?>=??=>=;HIHORQHIHGGGGGGSKGGGGGGGGGGGGGGGGGGGGGGGGZRTUTTVVVWWY!Y#Z$[%Y'Z)\*\+\-\.\0[1]3]4]5_7`9_:`A}z:=z8C}EA>A=9=95<84;7396141-2.,-)$&#&"=<;!ehiºz}~uwwy{|ZWTGD?LIEKGCJFCJGCGD@FB?GC@B>:>:6=9662/0,*)%!KKLKMR""_NKKKKKKKKKKKKKKJJJJJJJJJJ]YYZ[\]]]]^\!_#`$_%a'a)`*a+a-c.c0f1e3f4f5g7f9g:gF~=D};D|9Az9>y7=y5;x38w28v17u/5u.4s-3r+0p*,m)+m'*m$)k#'j"'i!$g "g!e dcb`^]ZZZYY X W V TTRP̿{|~jnmYZX72.61-=:7[^^վvxybddcedbdd\^^]_`~ddNKKKKKKKKKKKKKKKKKKKKKKKK^YZ[\]]]]^_^!_#a$`%b'b)a*b+c-c.d0e1f3g4g5g7h9h:iG=E;D}9B{9@z7>y5l?lAmCnDpFpHoIpJrLrNtOtPuRvSvUwWzWzY|[}\^^`acdeeeeeeeeee~e~e~e}e}e|e|e}e}e|e|e|e|e{e{e{e{e{ezezezeyeyeyexeyeyexeyeyewewewexeyezezexeueudtdtdtdsdsdsdsdsdsdrdrdrdrdrdrdrdrdrdrdrdrdrdrdrdrdqdqdqdqdrdrdrdrdqdqdqdococococncndncmbjaj_k^k]i[gZdXbWaU_T^R\Q\OYNXMWKVITHRGQEPDOBNAL@J>Gy3JLP=N~/<|-;z-;z+9x*8w(6w&4u%2w#0x"/t!/r -r*p'o&l%k#j"h"hgffdb a ` _$i \ [ ZYZ\?>>ϞBCTSSSSSSSSSSSSSSSSSSSSSSSe\\Gnnmnnpopqqq!r#r%r%q&r(t*u+v-x.x0x1y3w4x6y7y8z:z;z={>|@{A{C|D}E~F}H~JLMNPPRSUWY[\]_`acdeeeeeeeeeeeeeeeeeeeeeeeeeeeedddddddddddddddddddddddddddddd~dddd~d~d~d~c}c}c}c}c|d}d}d}d}d}d}d|d|d}d}d}d|d{d{dzd{d{d{d{d{dzdzcybwav_w^u[sZqYnXmVkUjRhQdPcObM_K]J]I\GYFXDWCUAS@R>P=N.<~,<|+:|)9z)7z'4y%2w#0w"/t!/q -q*q)p'o&n#l"j"i ghhgf d c b `` _ ^mnoHKKy{|ҞPPVUUUUUUVVUUUUUUUUUUUUUUUgqrssrssrrst!u#u$u%u'w)w*w+x-|.|0}1}3}4~6~78:;=>~@~A}CDEGHIKMNOQRSUWY[\]__abdeeeeeeeeeeeeeeeeeeeeeeeddddddddddddddddddddddddddddddddddddcccccccccccddddddddddddd~d~d~d}d}d|d{d{d|d{czay`x_y]v[tZsYrWoUmTmSkQfPfNdMaL`J_I]GZFZDZDZAVBV?S>Q>O;N:L:I7F6G3D3C1A/@.>,<+;)9)8'5~%5{#3y"0w!/u -t+r)r&p%o"n lkikkjj h h g edc b񘘘GHHSTQԤ‹ZZYWWWWWWWWWWWVVVVVVVWWWWWixyzzxxxxyzz!y#y$z%z'{){*z+{-.0134678:;=>@ABCEGHIKMNOQSTUWY[\]__abdeeeeeeeeeeeeeeeeeeeeeeedddddddddddddddddddddddddddddddddccccccccccdddddddddddddddddddddddd~dd~c}a{`z_{]x[vZuYtWrUqToSkQjOiNgMdLcKbJaH_E]E_C]AZ@X?W>W>S:Q9O9M7K5J3E2D1C/A/@->+>)<)9'8%7#5~"2}!0{ .x-u+u(s'r$r"p omlmll j i h ffed[ZZ:62窪vwyVVZYYYYYYYYYYYYYYYYYXWWWWWi~~!#$%')*+-.0124668:;=>@ABCEGHJLMNOQSTUVXZ[]^_abdeeeeeeeeeeeeeeeeeddddddddddddddddddddddddddddddddddddddcccccdddddddddddddddddddddddddddcccccba~`|^|]{[yZxXvWuVtSqRnQnOlNkMhLfJeIcGaE`EaC`B^@\?[>Y=W;T9R9R7O5L3H2G1E/D/B-@+@)?)<':%8#5"5!2} 1{0z.z+x)w'v%t$s"pnonl j i h fgfdnnm;63ᳳvvxBB]\\\\\\\\\\\\\\\\\[ZZZZZk!#$%'()+,./124668:;=>@ACDEFHJLMNPQSTVVXZ[]^_abdeeeeeeeeeeeedddddddddddddddddddddddddddddddddddddcccccccdddddddddddddddddddddddddcccccccccccba`~^}]|[yZxXwVuUsTsRqQoPnNlMkLjKiJfHdFcEbDaB^A]?[>[=X;U9T9T7Q5M3M2J1G/E.D,A+@)@)>'<%:#7"5!2}1|0}.{-z+y(x&x#v"t rqqo m l j hhgdめ<95ֵssu))x^^^^^^^^^^^^^^^^^^^^^^^^o$!#$%'()+,./124668:;=>@ACDEFHJLMNPQSTVVXZ[]^_abdeeeeeeeddddddddddddddddddddddddddddddddddddccccccdddddddddddddddddddddddddddcccccccccccbbbbbb`_^\[|Z{XyVwUvTtStRqPnOpMmLkKiJhHfFdEeDeB`A^?\>[=Y;X9W9V7T5Q3N2L1J/H/G-D+C)B)?'=%;#9"7!531.}-|+z)x'w+{$w"v!urr q n l ihg gUVVmnqaaaaaaaaaaaaaaaaaaaaaaaaarQ% "#%'(*+,./124668:;=>@ACDEFHJLMNPPRTVVXZ[]^_abdedddddddddddddddddddddddddddddddddddddcccccccdddddddddddddddddddddddddcccccccccccbbbbbbbbbbbba`^][[YW}V{UyTwRtQrOqNoMmKlIiHgGfEgDgBdAa?_>_=[;Z9X9U7T5U4S2Q1O0L.J-H+E)A)?'=%;$9#8!7 641/-|*|&z){#x!w vut s q o nliiRUTnotbbbbbbbbbbbbbbbbbbbbbbbbbs  "#%'(*+,./124668:;=>@ACDEGHIKMNOQRTVVXZ[]]_`bcdddddddddddddddddddddddddddddddddccccccdddddddddddddddddddddddddddccccccccccbbbbbbbbbbbccccdcba_^][ZXVUT}RzQxOvNuMsKoInIlGkEkDjBgAd?b>a=`;]9Y9Y7W5U4S2Q1N0N.K-I+H)E(C'B&=$:#9!9 7630.+*}'|%z"y xww u s s tqm lefizz|σccccccccccccccccccccccccct "#%'(*+,./124668:;=>?@BCEGHIKMNOQRTVWXZ[\^_`bcddddddddddddddddddddddddddddccccccddddddddddddddddddddddddddccccccccccbbbbbbbbbbbcccccdddddddba`^\[ZXVUTS~Q|PzNyMwKrIoIoGnEkDlBjAh?f>d>c<`:\8[7[6X4V2R1P0P.O-L+K)I(F'F&A$>#?@BCEGHIKMNOQRSTVXZ[\^_abcddddddddddddddddddddddccccccdddddddddddddddddddddddddddcccccccccccbbbbbbbbbbbcccdddddddddddddba`^\[ZXWVTSQ|P{NzMxKuJsHqGpFpDoCmAi@e?e=d?@BCEGHIKMNOQRTVVXZ[]^``bcdddddddddddddddddccccccddddddddddddddddddddddddddcccccccccccbbbbbbbbbbbccccccddddddddddddddddba`^\[ZXWVTSQP~N{M{LxKvIsGsFsDrCoAk@h?h=f?@BCEGHIKMNOQRTVVXZ[\^_`bcddddddddddddccccccdddddddddddddddddddddddddddccccccccccbbbbbbbbbbbbbbccddddddddddddddddddddddba`^]\ZXWVTSQPN}M}L|KyIwGuFvDuCqAn@m?j=h<9751/-*&%$"   ~ |zzyIKKfhi^_annnnnnnnnmmmmmmmmmmmmmmm|]@ "#%'(*+,./1246789;<>?@BCEGHIKMNOQRTVVXZ[\^_`bcdddddddccccccccccddddddddddddddddddddddddddddccccccccccbbbbbbbbbbcdddddddddddddddddddddddddddba`^]\ZXWVTSQPONLK|IzGyFwDvCtAr@q?m=k?@BCEGHIKMNOQRTVWXZ[\^^`acddddddccccccddddddddddddddddddddddddddcccccccccccbbbbbbbbbbcdddddddddddddddddddddddddddddddddba`^]\ZXWVTSQPONLKI}G{FzDyCvAt@s?o=m<<841/-*'$$ "   }{ILLPRRȋstuqqqqqqqqqqqqqqqqqqqqqqqe "#%'(*+,./0234689;<>?@BCEGHIKMNNPRSTVXZ[\]^`acdccccccddddddddddddddddddddddddddccccccccccccbbbbbbbbbbccccddddddddddddddddddddddddddddddddedcb`_]\ZXWVTSQPONLKIG|F}D}CxAv@t?r=p?@BCEGHIKLMOPRSTUWYZ\]__abcdddddddddddddddddddddddddddccccccccccbbbbbbbbbbbccccccddddddddddddddddddddddddddddddddeeeeedcb`_]\ZXWVTSQPONKJIGFDC|Ay@x?w=s?@BCEGHIKLMOOQSUUWYZ\]^`acdddddddddddddddddddddddccccccccccbbbbbbbbbbbbcccdddddddddddddddddddddddddddddddddeeeeeeeeeeedcb`_]\ZXWVTSQPNMKJHGFDCA}@z?x=v?@BCDEGIKLMNPQSUUWYZ\]^`acdddddddddddddddddcccccccccccbbbbbbbbbbbccccdddddddddddddddddddddddddddddddddeeeeeeeeeeeeeeeedcb`_]\ZXWVTSQPNMKIIGEDBA}@|?y=w?@BCDFGHJLMNPQRTVXZ[\^_aacddddddddddddcccccccccccbbbbbbbbbbbccccddddddddddddddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeeedcb`_]\ZXWVTSQPNMKIIGEDBA}?{>{<853/.+(& ' #  yzz̫~dee㭭Ǡ婩egiJMMvvxssssssssssssssssss!""$&'(+-/0134678:;=>@ABCCDFHJLLNPQTUWYZ\^_`bbdeeeeeeedddddcccccbbbbbbaaaaacccbbcccccdddddeeeddddddddddddddddddddeeeeeeeeeeeeeeeeeeeeeeeeeedcb`_]\ZXWVTSQPNMKIIGEDBA?>~=z;w9u8r7p6l3i2g1g0d.b,`+]*[)X'V$R#P"M!J HEA=;8642/,)' & # َOPR󋌌_a`Ôҍabduuuttttttttttttttttts!!!"$&'(*,-.0235689;<=?@BCEFFGIIKMOOPQTUXZ[]^_`abdeghggggggggghhgggggffffffgggghiihffgggggggghhgggffffffeeffeeefeeeeeeeeeeeeeeeeeeeeeeeeeeeddddddcb`_\[ZYWVTSQPNLKJHGECBA@><}:z9x9v7r4o3m1j0h0f.c,a+`*^)[&W$T"Q!O!MJGC@>;8621.*' % $ "mnooppxyzuuuuuuuuuuuuuuuuuu  "#$$&')+-..--/124578:<<<>@ACDFGIJKMNPQRSUVX\^^`bcddfgijkkkkkkkjjjhhgggggghhhhiiiiijjjjjjjjjjjjjjjihhhhhhfffggghgggigedddddeeeeeeeeeeeeeeddddddddddddba`^\[ZXVUSRQONMJIHFECA@?><|:{8y7w6u5r2n1l0k.g-c,b*_)^)]&X#U"R!NNKFDC@<9521.*' & % $˟yy{uvwmnoyy{ѽtvxORQwwwwwwwwwwwwwwwwwu "$&'()+,,/121024679:<>??@BDFFHIKMMLNPQSSTVWX[_bbdfghhjkmnooooooonnkjklllllmnnnnnnnnnnnnkllllmmmmmmklmmmmmkjjjkkkkjjjmmkjhhhgeeddeeeeeddddddddddddddddcca_^[ZZXVURQQOMLJHHFDCA??>;:{8y6w5u4r2p0m/k.h,c+a)`'_(^%X#V!R M KJGCA@;8521/,( &ҫ۝ppsjji><<:97}7y5v2u1r0p/m-l,h+d)a(^'[%Y#X!T Q OKGDA?<9620/,*[YX欬mmo랟OQQoppਨwwwwwwwwww | {ww.O ./024678:<==@EEEFHIMNQRSTVWX[\\]_abcefgiiljikmprrtvxxwwyz{{|||{}{{{|~~~~~~~||||}~~~}}}}}}z}~}}|zyvrppoprqoosokkihihgcccccb`_]\YXXVTSQPPMLKHGFDBA?>=<9875z4v3u1r/p.m.l,g*e)c)a&\$X#V!T Q NLIEB@<962/.,)ՔRTUVXWTVV훛NOP[]\㦦wwwwwwwwwwx {wwe\I235789<=>>ABDIJIJKMRRUUWXY[]_`aacehkmmoqrpmnnptliijkkxڂ~~|yxwvxzxusvwvsrqpplfhgddb`_^]ZYWUTSPONNKIHFEDB@?><;:865|4w3t1s/p.l-j+i+f)b(`'\%Y#X!S QPMJFC@>:630/+(gdb ;99UWW^\Yxz{wwwwwwwwwww zwwP<>@BCDGHJKLNOOQSTVWXZ]]_`bc`acgijlqtvwvvvuuxy{~Iag333333333333333`~~}|{y|~{xwupqtsqmmkdadb`^[WURQPOLKIHFDCBA?><;;975}4{3x1r0p/n-k,h,g)e(`&]%\$X"T!Q OLHFC>;884/-*(C>;a_]QSSsuvEDC730ڥwwwwwwwwwwwww;tFHIKNPRUUWX[\]___bdefhhilnonoqsuxx{}~zy||Jbg333333333333333f|||zxtrplijhda^ZWURQRNKJGFECA><:98742}1z0z/v-r,m+j)g'd'b%]%["X!V SNKIEA@=:710/ * ' %qrqdeeOQQpqsFCC31-␑捎wwwwwwwwwwwwwJNTVTTYWXZ\^_`bilkhoqsttwxxz{~{~Lbg333333333333333g~|{zytoligjfdc]USQQTSQOLEA@=;;:;;511}/y,u*r)q(o(j$f"d"a!]YUQOLJFC?:96 4 0 - +)%ssuggirsuGDD1-+Ჴ폏zz|wwwwwwwwwwwwYYWWX[`efhjjmoonoopsuvwx|{|~Pch333333333333333p~|yuromjgeec^\[XXUUQPLKF@CDCB=:8~6y.s.q0o,m*i(d&b$`"ZUTPKJHE@; 7 1 / .+(($׶bddssuECB841ݲ|}}wwwwwwwwwww^``acegkoopsuxxwyz~Rch333333333333333s}ytqnmligfda_\[[YUSQOKGEFGFA=:~8{5v0r0q2l.h*e&b%]#XUSPJFDA> : 60+)&"!ꦧcedbcdttvEDB:73亻vwx২wwwwwwwwwwwfjmmortstvvy|~~Udh333333333333333x}zwtstwttrokhhgd\URPONLKLLIFC{Ay;w7t6p7l7h4d0b,^)X#TOMJGB?<8 30 -(%"{{}˒^^\MMM򘘙rrtԚJHF62/`bcwwwwwwwwwwzvpsuwz~|Xeh333333333333333~꒯ܡ„褼~}ͺ~|zyvsm`RpOnJmHjGiL|RWTRQOMM}GyCv?rj:e9a9_5[4V0T+R)N%I B> >=:840-**'# |~}ٽc_\#!䐒||}/.+/+)jklwwwwwwwwww\eh333333333333333333333333333333333333333333333_fg333333333333333JMM333333333333333333333333333333333333UYZ333333333333333333333333333`ef333333333333333333333333333v333333333333333VagT_f333333333333333o튽튻돵錳s>CK333333333333333333333333333333333333333333Sk\|XwVtQqMnIkCh>d@`@Z=V:T7Q3N1L,J(E*@+=':$7!5 530+'%$!   RSSpmjsvv옘֜׽/.-0-*]__wwwwwwwwwwao^fh333333333333333333333333333333333333333333333333afg333333333333333333333333333333333333333333333333333333333z333333333333333333333333333333befJLM333333333333333333333333333333333333333333333333YagU_f333333333333333r럿雽阻藷痳n333333333333333333333333333333333333333333333333Wibx]v[qWmSiOgLdJbG_CXBU?S=P:M8K5I3G2C/=,:*7'4%6$5 2+&##! Y[[zwuPNL򙙙:97uvvkmmwwwwwwwww{9`fh333333333333333333333333333333333333333333333333?@@bfg333333333333333333333333333333333333333333333333333333333333?@@333333333333333333?@@dffdff333dff333333333333333333333333333333333333333333333333333ZagW_f333333333333333r럺蝺蚸皵儐333333333333333333333333333333333333333333333333333[hhwbs_n[jYfWcS_L^H^E[BVAR@Q>L;J7I4G5C3<.9,6)5'3&3#/*($)! noqPNL 0.,rsuNLJ(%"WYYfhh_`bwwwwwwwwdafh333333333333333ynst333333333333333333|cfg333333333333333XZZ333333333333333333eff氳~333333333333333333333333qss󔘙333333333333333333??@kpt333333333333333333333^af[^e333333333333333x骼驹觸妸䣷BDJ333333333333333333KN_hm}ՃzbjORr88=333333^fmthrepck^g\dYaR_M]KWHUJRIPELBI?==::886523.0,.*+'(#$ ![]^]_`{||_`b<;:njfoquqrtIGGTRPaba999|ffg#wwwwwwwK bfh333333333333333dfg333333333333333eff333333333333333YYY333333333333333333333333333333333ffg333333333333333333333333333333``f^^d333333333333333澾㼼㸷ⴴ㱲ⰰLLU333333333333333kk֖ՒԎԎ҉чυ΂}|yywwvvtuqrpojjffddaa]]ZZXXUUQQPPMMIIFFBB>?>=;:78463300..++(($$!!ijlsuuhklTVWA?=gd`rsuʺB@>@<8NPOLJG񍍎GGFuuuuuuuObfh333333333333333333333333333333dffeff333333333333333333333333333333333333333333333333333fgh333333333333333󒒙333333333333333``f\^e333333333333333~弽㺹㶶㳴㯲ᯯ333333333333333333jl|y}w{vwuvssqqnnmliiffddknrwprnngieecc``]\YYWWUTRRPOLKHIFFBB=?<=::684623./,-+*('$#!!~~~CCATTUa`^gfdstvDBA>:7\[]630𖗗Z]^vvvvvvvafh333333333333333333333333333333dffdff333333333333333333333333333333333333333333333333333fgh333333333333333333333333333333_af[^e333333333333333}湾嵺岷寵䮳ᬰ333333333333333333333333333333333333333333333333333333333TXovmrjofkch`d]aZ]W[TYRVOSMOILGJDG@C=?:>7<584502-/*-)+&'## !VXW<:8hjiqrt𤥥B@?@<7\]_PRR$![]^WYZxxxxxxxoAafh333333333333333333333333333333cffdff333333333333333333333333333333333333333333333333333egh333333333333333333333333333333^agZ^e333333333333333z鵿籾篺筵嫲ᩱ333333333333333333333333333333333333333333333333333333333TXntjtgqelbh_f\cY_U[SYPVLSJOGMDIAF>C;A9?7=4915/2-.*/'.%)"%#"]__fc_ \^^vxyQQPMKIgiiSUV[_^=?><;;JKJyy ~yyyy'`fg333333333333333󑘙333333333333333cffdff333333333333333?@@333333333333333333333333333333333ehi333333333333333333333333333333]agY]f333333333333333y걿讽笸窵娱⤱BDJ333333333333333333333333333333333333333333333333333333SXmwhtfqdlai]eZbV_V[SYOVKRIPFMBJAF=D9C7>4:27/5.3,/)/&-$(!&$#[]]䝝OMK61.??>ŀWYYɖ؝sutQRS[\]GJJgii]]\<84MONxz{hhi)%!yyyyyyyJ^fg333333333333333bff333333333333333cff333333333333333cgg333333333333333}333333333333333333ehi333333333333333333333333333333[ahW^g333333333333333vꪽ訷馴棳䠲OUb333333333333333V_w`l^g^f_e^e\c=>H333333333333333PXfxbt_q]l[iWeTbS^T]OYLVJTHQDNBJAH0;/6.4-3*1&0$,#&#  \^^~ mjiʷefe>A?HJI[\]xxz¹uvwssufed )%"]``{|~MNOWXXIJJ(%!zzzzzzzB]eg333333333333333333333333333333333aff333333333333333333333333333333333333333333333333333ahi333333333333333333333333333333YbhT`h333333333333333;=@_mz៺뜷錥Όgv333333333333333cu}~}{x@ES333333333333333Ui^y\vXrUmUhRdOcLaJ^H[FXCRCO@N?J,:+6(2%4#2"-(%$"]_^LHF>==da_"DB@泳̒vwxoqqPRSged 3/,ݗ߻DDD*'$|||||||~X]eg333333333333333hqst333333333333333333`fg333333333333333333333333333333333UZ[턐333333333333333333333`hi333333333333333333333333333333WbiR`h333333333333333333333333333333333333cy333333333333333GQbzwsrpf333333333333333333YwZxWuVsVmSiNfKfHdD`B]@YAR@O@A}}}}}}}}sf\eg333333333333333333>?@hrt}HLM333333333333333333ILM_fg333333333333333v333333333333333333>@@ŰŚw>@@333333ǐy333333333333333333_hi333333333333333333333333333333UciP`i333333333333333333333333333333333333azSf{333333333333333N_yoqph=FU333333333333333ALiZ~XxSvTtUoPlLiIfFdD`@Z>X>W=ݶSPN}}}}}}}}}F}Ydg333333333333333333333333333333333333333333333333333]gh333333333333333HMM333333333333333333333333333333333333333333333333333333333333333333333333333333333\hi]hi333333333333333z333333333333333TciN`i333333333333333333333333333333333333_{r7;?3333333333333337:?CNa@Na333333333333333333333OjP|LyIwHvJtKnGjEiCe;`8]6[4W4T3Q2O0K/G*D$A!< 9741-)*(# "  ]__wxywyy_aa{}}^`b|~ſնľnppQSSA=9}}}}}}}}}Bvxx|Vdg333333333333333Te333333333333333333333333333333333<`DB?=}?|<:860, * ( % prr:==KMN]_`OPQopq988ƈLJIJIIgii⟟uw{ƾ^aaqssbce~~~}~~~~~xcnqrtwy{|~kSdhTdgTdhTehTdg~e}333333333333<@@grWfhWfhVfhUfhUfhrEMN333333333333333333N[\qWhiM[\333333333333333333VhiVgiUgiUgiUginoTgiTgiTfiRfiRfixsOdiNdiMdiMdiLci^WG`iG_iF^iE^iD]iXmjfODcuAYhQbZWSTI>Zr5:@33333333333333349?9WzBB?<745y4u=;99<:2220.,,/-'&%{%w.y#s n!j gc`\YVSQOKG D @ <:720.+*'##"gjjXX[oprߧjklSVV41.nmm蠟.,( A@>߻𮯯]^^eZ\[_`bdegghlmnmotvvtuuwvwwyz{{{|~hhgeddwȒ|333333333333333333~|zxzzwuttqmhc`_]ZWURPNKHDDEA9654431..-++(('$""!|!w*zrnmjd_^[XTR Q M FCA><862.,+)%$!PRRklmτퟠVYZQSTeefVWWhjjnpqޭuyy-*'(&#QTTrsuVWY\\^_`aacddedeefhmnnonnnpqqqrrrruvvvxyyz||}}333333333333333333`t333333333333333333z{}~}{ywutqnmkjjgc\[ZVUSRQOLIHEB?:831/--//-*%!###"!zw'{upmhc _ \ [ XT P P LFDB>:673//.)&%! 786ߧ񽿿SUU=??ikk劌0-)XZZzzyZWT 321|~~ͱ]__~~~~~~~~~~~ORTTTUWVVWXYZ[Z\^^_deeeefffggfhjiilmlmmmopqqrsw|{{zxxxxx~333333333333333333Z|||||||}}}}}~i333333333333333333}{{z~~}~rmqqppnljihdfhedcc[OQPKHHIFDBAA=:983*)'$"""%"~{x$}vpmfa`_ZWVSPKFDB@=<940/,))&$"%!CFD!=:5^``IJI:63󫬮DBAZXV~~~~~~~~~~~~FDFFGGGHIIJKJMONNPPRXYYZYZ[ZZ[[Z]\\]__``ababcdcjoonononnpponmnmmmmmlljn333333333333333333Pjjjjjjjkkklmsxxxzzzzz{ziRRRRQSlihnnlljoshb``_]\[YXWUVVTRTXQGDCB??>967<;642.*#"%  }|"xnifeb_[XURNIIHDB@>:520/.-'%$""!fgh󰱯 >??% ;<:նлzwxYUVxxzBCD-+)KHE.)%~~~~~~~~~~~~889;:<<==?@BBCCDDDFHJJJJKKKMONNOPQQQQSRRTUUVVVY[X[\\\]_```a`_^]]^^^_`b333333333333333333Mccdddddeeeeeghhhiiiiijjhdeggedddceb__^`b_[ZZYVUTRQPNLKJIHIFA=?=9743001/*'%#!   }{~ pkgca_^[XSOKHFDCC=:84130+)(&$" dfgTVW]^^GB?hjjllkݷϳ̰4?2TNQَ;<=SUUz{{`cb?2244466678::;<=??@?;;;;;<==?@@BBCDEEEFJMMMNNPQLJOSTUUUUWYYYXYZZ[[[[]]]STQMMMRWWWXWZabaaa`aabbbbbccdb]`dc[X`a`__\[[ZYYTQPPNMLNQOLIHGFDBA=;<;8630/-,*'%#  |zxwtnifdb_[XUPLHEDDB<98543/-*)&&#EGG[]]mlnSSQӚHKIjռղ˴̳ʽXe] KMK꣥bedACBA>=<50/.+*(&$"#$! {ywtqlgec`^[XUQMLIHGC?;98631/-*'&#ӅHHHDDAcddc_dŠRwa׷δ̴̳n""121ljiCED-.%%&&&(()))++-..../.+,,-33440/12333454:<;<=====;887899:::::;<<<>@AAA@DJJKHBBCCCCCCCCCCCCEJLLLLMNMNNNNJFFFFGFECCBBAAFGFA=;;:8763368865321,&$#!  ~{xtoljfeda^[VSQPNKKGEA=;=7320.-+($! qpp|}}=@?nqqhiiYVY{͌Vtby̺мӢ޾ٲЇǣ;SA \[YڊFFE}~}#% !"!""#$##$%%&&&'('$%&)**)*)))*+++,,.11133455622445444665567765556667;;;;<<;;:::8:>>>>>>@????ABBBBBB?<<<;9;;::98889:9743320//--.-+(''&$"  }yutoljhfcb][YTPPMKJFEB><;951//.*'$#" TVVVWWSSSJJHSTVzа͌ǥTpfǡƭǪس֮İputC9=/-*RSS펎0/.\][STVEGE  ! "##$$$%&&*,++,+,--.+-0//000000000000001110/0.1775544314:;::::99999::;::::53331266545666423/+++))*++*'&%#"  }{yvtpnkhfca]ZYURPLJIDCB><;9520.-)'$"! /1/deccdd݋~ͮӸЎخ]xLd͑ٱqْ}uxxvIJE&!nnnGEDkifEGGTVVn! "&&&%&&&&''%$&&&'''&&''''(++++++*)**(,1000//..0111112222221133344-+,*)-,+**-//....'$#!"$$$"!  {xwvqomjedd`\YXVTPMKIDA?>=;8431.,*'$! 31/354A<8lsp̯ɭǐذ\ssϼF|Yʹ̔ϰYuMgw0/+;<8 =:8}XZY  !"""#&%%%$$$##$$%('''('''&&&&&%%%%%%%$$()**)'&&$$$##!%#!! #$$ ~zwvtomkhebb^ZXWVRNLJHEB@?><75310-)(%"!!ϰ<=<<74ltqRjըҦӧӨ׭֨\uITMLHKMMNuovT~fqǢ׻f+B/OIJeca,)'VWW+,F   }ywvuronjfdb`[XWWTPNOKHE@A?;96421/,*'##" ៟jkmQSSQSSUWWBBA:52þv{yԩӨӨԩ׬է^wLVP/%&#\^^KLMQcwƝӶ^thCADsuv򦥦DA@+($quursu}|~̓tuv    ~|zxvspnkifdb`[XWWTQNMHEDB@=:86321-+($$$" ;98@A>".+(DFFDEFBEEFII{z}ۡԩԩӨӨدhHWN/%& ]_^-*(" EKF}%5&D>@铕=;;%!(##1/,gjh󒓒[]]\\G  ~}{xurnlkiec`]\YWVVSONKGEDC@>;86321.+(&$#!9;9IIH㨤{ǥתԪԨԩثزu/)(```ޔ-)%'" 0,+U[V֮XrK_RLMN՗tsr@><-+)𝞞KMNstu   ~zzyurpliggda_[ZXUTTPNLHEDB@>;975442-+('%$" zz{IKLvwxaqU[YccfgzpȦ׫ԩӪ٭٭`pi HEDװyxxyyyjhiPMP^o̟ԫh~sghg=<XFB:=z{zGJIɃ$ 3333333333333333333333333333333333333330=A333333333333"q3333333333330=A333333333333333333333333333333333333333333~|{zyuqomjhfdb`\[[XUSQNLJFDDC@>=:86441,+)&%#" yy{699yS~d?;<@=;ݭf͌b}Sl@=="51.EC?0))LkYXzpzRKQwyxFHI復Q%333333333333333333333333333333333333333333'[i0=A3333333330=A333333333333"dw333333333333333333333333333333333333333333333||zyvtrokjhedb_\ZYWURONLIEDDB?<<976441.,*(&#! }bcfjjkVXYҥðtOLNIEH[tf׫֮Sg1/*[Z[ڀ3+,6V>xezHTLRXVlmmJLL 333333333333)Q\333333333333333 o333333333333y)P\333333333333333333333333333 z3333333333333330;@}{zyvsqoljjheda_\YXVTRONKGEDCA?>;776441.,*('$! eIL]10.61/菏o˕Q|UwQOQMdUbLJ۫լԧV{OOPvquDhSwiʏẂY|IhV~XY[]^^˲333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333c~}{{yxtrolkjheca_\[YWUSPOLIFDCB@>=;866541,+)''$!!  f421;RV\UVY𩪪rW~X{OgZp׭էX~RjQSQ}x}HiVWxQxy՞rEhRtkrVXZdgf}333333333333~&Xi333333333333~333333333333333333333333333333333333333333%Xh333333333333333t3333333333330;?~}{ywusqnkjgfca`]ZYXVTRONKIGFCB@><:765541,+)&%#"!!  ϸOSSLVP)-$ 34.LQN.0)'(!*-%TZXqstjV|X\ā[W}Thqam|}, z333333333333|)N[333333333333{"`v333333333333333333333333333333333333333z333333333333333333333333333333~|{yyutpmljheeba`\ZZWUTROMKIFDB@@>:776442/-*)&%"  莕  ==776QPQnnnQPP331?AB_``rTtYw]Ã_ڌ\ӇXZvn晘]@t333333333333%Thuuud333333333333333,DM333333333333g333333333333)LZ333333333333333g333333333333%Pd~|{yxvtqoliigca`_\YXWUTQNMKIGECB@>:765552/-*)''$!!! ,3엖FHGnooͰijkGIJPMJqqrZha9L>/;.2L53X:GkR[tQpZt۸Kr3333333333333333333333333333333333333330;@ )KZ333333333,DM|333333333333k333333333333333n333333333333%Oc}{zywvsrplkjheb``]\YWVTSPNLKHFDB@>=9755541/-+*(&$!!  oppNML"#"PQQopp'&$[\[㛜ᤣfgg@BB243GKJ[Z^OHL4./1),!HKHXmseo333333333333333333333333333333333333`p333333333333 "Zt333333333333 333333333333333l333333333333%Nc~}{ywwvtspnmkhgecba_[[YWTRPNLJIFDCB><;865563/.,*(''$!! &&'9:;IKLz{|21/uvuэGDAVVVcdeFGHfhgz}}__^41.(!!:D<~l333333333333333333333333333333333,AM 333333333333m0;@333333333,BM333333333333333[}333333333333"So~}|yxvtsqonkjifdb`_^\YYYWTROOLJHEDCB?<:875540/.,)'&%#! & #XXZHHHgcbWWX_enDHSXZ\^_`jlnuwxæa`^(!!KXQUi333333333333\q)HZ333333333333 ,AM333333333%Nf 333333333333\333333333333333)FX333333333333d~}}|zwutqppmmkihec`_^]ZYXXTSRPONKIFECAA>;965530/-,)''$"" 14jkk䂂#XWV䞢YZXxz|hijwsu+*f333333333333f09@333333333%Mfa333333333333`333333333333u333333333333333333333333333333m~~}yyxwtrqoonlligedb_^^]ZXXWSRPNMLJHFDBA@>;766531/-,(''$"! [MLQbccfffvyxykkm롡FGHsssdae333333333333e%Lf333333333333y333333333333333333333333333333333333333333"Qp33333333333309?~~}zzzwvtqpomlkjifed`__^\\XUWTSROLJJHFFCAA>;9766531.-,)&%$!! g!!!__`欫]^^MPNNQPHJKvxx[ZZggg䩨%%d333333333333d09@333333333333v09@333333333333333333333"Rr333333333333333W|333333333333333`~}}{yzxutqpnkjiigffdc`_^\ZWUTRQQPMJIIGEDB@>>:556531/-,*(&%#!   _kll[]^$ UUVTTTҡ""b333333333333Vstn"Pr333333333333333uV~333333333333333333333j333333333333333tsra,?K333333333333333,>J~~}~}{zxuwwurpomjhgfeebc_^^]YXVTTRPPPMJHHGFCA??=9656530.,+('&$!  o#"&MNNؑEFF||}()  ~~~~`33333333333333333333333333333333333333309?l33333333333333333333333333333333333333333333333333333333333333308? q}}~zz{xwvutssqpnkiihfedb``_^[[YVTSRPPPMJIHHFCBA>==9565541.-+(''$!  eIIINOPvxy̅ݝ<<=tttLLu}~}}~~~~}}`333333333333333333333333333333333333333`333333333333333333)CX33333333333333333333333333333333333333308? o~}|{{{zyxxvuttsqpolkjigeccb``_^[ZYVTRQPNOMJIIHHEAAA><<964543/,,*(&&$!  q#%AI !;HIJggiʢxz{qqqaaa%%||||||}}||}}}}}~~~^333333333333333333333333333333333333^"Nq333333333333333\~333333333333333333333333333333333333Ozu{{|zyzywwvtvvttspmlkigefebaa``_^[YYXUSRPPMNKJJIGECAA>;98754331.,,)&'&$!  eUUUJLMOQQľjigvtqoomefg8740-*}}~PRSσ;;R({{{{{{{{{{{{{{{{{{|||||||||}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~`%Ge%Ge%Ge%Ge%Ge%Ge%Ge%Ge%GeQ~[t~~~~~}}}}}_%Gd%Gd%Gd%Gd%Gdr{|{z{||{%Fd%Fd%Fd%Fd%Fd%Fc%Fc%Fc"JoW\rwvvvuursvuussssollkkigfedcaa`_``][YYXVTSRPOMLKIHHFDBA@=;87644300-++(&'$"   v]C__]<<=;8554430/.-)&''$!  ]BBA\`f`do?<962/Ը}}}zzzxppoqqrqqrfed][YVUTTUVacfMPP@BB" Z[[ӡBA@2/*HII_bcccbqom@>;Ǡ{re\Ixxxxwwwwxxxxxwwyxxwwwwwwxyyxyyyxxwxyyxxxxxxxxxxwyzzzzzzxvvwxxxxxxxxwwwvvvvvvvvvvvwwvvvvwwwwwwwwwwwxxxxxxxxxwwwusssrrsrrtustuuuurpomlllnnlmmkkjhiifegeccccb``__^]\\ZYXWURRSQPNMJJHHIGDBA@><;:655530/.,,(%''$!   GWWVČuqn؂ZYYLJKJKJJMLPV`PV_SYc\ahghgSSP 72-kmly{|ijk73/320mxekpIJGGGFABA%! 1119;:..-???a``}|{TSO}ȏPuuuuttttuuuuuuwwuuuuuwwwwwwuuuuuuuuuuvvvvvvvuuutvvvvvvvusssrrrrrrssrrrrrrrrrrrppppqqqppssrrrsssssrrrrrrqqqqsspmmnonmlkkkkkmoopqljjhhhgghfgiiihggecbecaaa_^][Z[[ZWVUTTSRQPNNMKIHIHHFDBA@>=<8765541..-,*'%&&#! (+d@@?SSU,*){xu663 ;77~}Ɗʯܾɋ*&"kln :94}Y[[,)%$+'#LLJbee_bb@=<# .,+JMMEHGOQRZYVlt~ː;tsssssssssssssstsrrsssuuuuuusrrrrrsrrrsssssssrrrrssssssrppppnnnoonmmnnnnnnlllllkkljkmlkkkklllkkkkkjjjjjjiiiinojiijkjiijigghhhijjggfffeedbbcbcdddc^^__]]][YXWUVWVTSRQPOOONLKKKIGGGFEB@A@>=;:766553/.,,*(&%&$"! rvrz}[ZUqssNQR`a`}ƭ߽ny(#![[[YZY'$ ejoSUU0,("IIHuwyOLK-'#(#!:87Z^aQTUWXYtslqxΈqqqqqqqqqqqqqqqqqqqqqprrrrrqqqqqqpppppooooopqqppqqqqqqonnnoooooomkklllkkkjiiiiiijiiiiijjjjjjiiiiiihhhhhgggghgeghhhihhheghhfeffdccdcaaa`aa_^__^^^ZZ[YWWWVUSQQQQQONPONMMLJHHIHFEBBDA==?=;:86545431/-++(&&%%#!  ae}zmlh[ZVflwؿySVYvwxOQPxbec$ caaYVR'%jsϖs|nmj~̅pppqqqqqppppppppppppppqqqqqoooppppppppnmmmmnonmmnooopmkkklnnnomkkkkkkkjjjjiiiiiiiihgghhhiiiihhhhhhhhhggggggebcbbeffeeedeedddda^]^ba```^__^]]\[ZWWVUUSRSSQOONOOMLMNMLKKJHGGGFEDBB=;;:876555455420.,**(&&%$#!  QUѲ჊tpi6:@D;1x|{deehhk]bk9:7JKMLNNpw|ױ雥ooooooooooooooopoooooooooomllllllmmmmmnmliiijmlkkkkmnjfggfeeegiggggiiiihggggghhgdcbbbbbbaaabddddeeeddccddcc___]\_a```_`_____^\[ZYZ\]\[Z\[ZYYXWURRPOQQPQPMMLLLLIHJHFFFDBA@@A@??@?:765654331131...,++(&&%$#"! PTz|櫸ҭ۫ꂆ:;;a_Y631FFDklmggg|TWXghh0-)ca^:85cfpϠnnnnmmmmnnnlllllkkkkkkkkllkklkihijkkkllhggggjkhfffffeeedddccbccbaabddddeecddcccbaa______^^^^]]\]^^^_^aa``_][[ZZXW[^]\\]]\\][XWVUUSUWWWVVVTUTTSPPONLLLLMMNMKKKKHDCA?B@??@><;:;:;:74432320/.--,+,-+)+'%&$#"!  UX~~mlkqu}熅>?>ijf¿ABCKKLnoohhk`a_DFFsmc+(,CA@LO[稻񃑬zvmmmmmmmmmmmlmmljjjjjjjjkljiihiighhhhfgfffeeeddffdddcaaaaa``a`___^^^^]]]^_^^^``_\]][\\\\\ZZZZZXY[XXXWVYZYYYWUVVVUTTVXXXXWWWXVSSRRQPPPSTSRRRQQOLJKIIGGHGEDFEFEGFA>>><=;;=<<;;:89733210.//+,,,*))(''&('$$#"!  hlfgeKIN'!VY`򀉞?CFlkeۭkmmzyxVWWVXYAAD_agKJGILX{SW^ahtyklmmmmmmmmlljiijhhikkkkihfffffgffeddedcddaa```bca`a__^^^^]^^\\\\\\\[ZZZZZZZZ\[[YYXXYYYWWWWWWWVUVVUVTTTTUUSRRRQRQPPQQTUTSSSQOOONNMLLKMPPONNMMJGFEEDDBBA???AA@@?<;:;:777657668552/0/,-,+**,+**)&&%"!!   -5YXT_ftWY` EFQژŗחt}68:XQHijj|SXZhjjĨƾ=;<;=<;;976664223110///1/-++*)'(''&'&%$$$#!     `deb`<>Ery?;7]^`δ稷هvxwrp|wtz?@>FB=^][els]^^ຳ??Bbgs|A?:Z]eր}}}aoffeeffffffeeeeedefdcccca_`aaaa^^_````_]\\]^^]]]]][XXXWVVXYXUWZZYXXWWWVTTTUVVVSRSQQQPPRRRRTSSRRQQQRQPPPPOMLKJIJIKJGHGHLLKLJHGFEFEEEEDCBCEFED?>?===<=>>=<:9::87433430/00.0/-+*,,+''&&%$$$" !     uSUS9:4LNK[ZYB>:,+(iigӖǂɚ΃jllо[aiˆOQPkmnȎWYZxZWS0,(GD@`_\LMLoqr{9efdcceeeeddbbcbbccaaaa_^___]]][[]]\\Z[ZZ[ZZZYYYYYUTSSSSSSRRQRUUUTTSSSSRRRRPPQNNNMMMLKKLKJLKKKMMMMMMLLKLJGGGFEFGGFEEDEGHIIECCBBBA@AA@@=<?AA>::;9888787886667520010.-+,-/.-++*)'&#""$$"""!  ErqsӤMPP|}~,( JLV᫼ܩ۩ݯFIIxz{̶jjfAEG{xzSTSVY\IJFILZ]^딟Y[^WYW^``Ǣdeedbcbccbba__````_^^_^]^]][[[[[[ZYXVVWWWVUVVVVUUSQQPOOPPPOOPOOOOONNNNNOOOONLKJIIHHHHHHHHFFFDDFGGGHHGGHHEDCBCDCBBBCBCBAAEB????==<;;;;;;88<;87664344310120110/,,**)((%&((%&'&&$  !   #V*))_`a蜝&"VYgNPQOQPMOOMPRÎY_hSUTGIK;=>=>><<;=;::::9778866775344431000//.--,**+*(('((%$&$###! ""!   Z)))PQS뒔%!\^f쉊qqrѴҴӶyy}jln~竺ۄwww}~ŽƹqsuSSQVaw_`LXa`__```_^^^^^^\[ZYYYYUVUVVUUUSSSRSRQQRQQOPOOOOOMLMKKKJJKJKLKJIIJJIHGGGEEEGGDDDDBDEDCCCBBCBBAAAA@@@?===;<>>>;;;::::99998678887667666435420/.//..--+++**(('&$%"#%$"#"##"!   OZZ[LNNsuu:94y}Фο˞ϝʮܽz}pok­qniٽmw𧩩RTTK ___^^]]]]\\^\\ZZZYXXUTTSTTSRSSRRQQQPOONOPOOONMMKJIIGGGHJIIJJIIHGGGGFFFEDDDCBAA@?@CBAAA?AA@?@@>????<<<988;<;:::99998999655567755544422210/,)*+****))(('&'&%"" ! !   `auwvMOPprr<<7{ehqjieŦvtodl|p{pqqbbO_^]\[ZXZ\ZZYWWWXXWUTRRRRRQPMMLLLMMMNNMMLKLLKJJGEFFEEEDCDBABDEDCCCCCCCCBCCA>><<<<==;;;<;<<<;:::9999886466678888888777663///231/000/.....,(''''&$#%%'&&&$""   VWCA?GEDqrt984xꔢɧozYZ~]][[ZYXXXXVUTUUTTUSPQPNMMKKJKKKIJHGHJJIIJIIIHEDDBBCBBB@@@??@?>@AAABA@@?@=9;<::988866656687788777666333222466554432110.---++,..--,,,+++)%%&%$# !!   DE>==mllnppFFCq{}~|?@boA]\[ZZXWWVUUSTTRRQNLKLNJJKIHIKJIFFEDEEDCBDEDDDA@@>?>@@>>>>=<<<99=;;==<;;;8667666554444322223554342220////..01110///..,))(''''*+))(((&&'"!"!!   LMZ]^lnnMMKq|y{y?Ad'ZYYYYWWWVUUSRQOONJIIIJHHHHHIHGFEDDCCA@@??@??@=;<>?===>><;:8876777786778766544433212100..../.--./-.,,--,+,++.,,---,,+'&&%$$$$#%%$####" ]_jllMLI蚩ˊݹսp{|~|jlJWVUVVTRSTSSQPOONKHHGGGFEDFFEEEDDCCC@???><<<<;:::;;;;;<;98876554456532243331022211//.--,,+*+*+++**((((''&'&&))('''''$"""!     FFuwwED@郑^^ZX`vwtoᏗfnXXXgpoz]]BUTSSRQNNPMMNNLLKGEEEECBB@A@?B@?BA??>==<<;;9766754556555666543332233210..---.00.---+++++,*)(*+*((&%$$###""""#$%#""#    44o89;픕==9w~UYa*$'!LOS}2-& <<9m{nx鱱aafY~XUSRONONMLGGJJGFECCCBBA@@?>><<:;=;<<;::::88322221/0010002311210010/00/-***()+++))*'&((())&&&&'&$$"$"     RGHKQPNy틜ںy~~}ny뒓-/RsfSQPONNMKJFFECBA?@CB@@?>>=<:9979778755688510//.-.---...---,-.----,+..*(''''&&$$$%# !$$%%%"""!!!      UJJNQQMy}34VFPNMLMLHFFFEDCB@@@A@>?=<<;8766654231010111/.----,++++**)((''&%&''&&((%&%$#!!!     Ylkkcb]ovގttt"#JBNLJJHFEEFDCCBA@>>@><<;::97655444210//00,,--,++++*)((''%$$$$#"#"!"$%#"!     WOPP{tzLJ%%%##Wvf LLIHGCBBCCABA@>==><9;8767645433111/.-./++*+*(('&'&$$$$"""##"#%" !  jKLR[\^ˢ{&&Oxc KJHEDB@@@@??=;:;::86764444420/0.-.+**,*)')(&$$#!!" !$$"""!!  Udefˤt}EFH%$N JGGEB@>?@>=<9777556652433330./,,**)))&$$#$##!   Ugiiߥ珘llm%%/zsFEDB@@?=>>=:8776421///1210..-+*(('('"!"!  $$E઼ަצ֧إמНΝΝϜΝΜͤէئקئצڸ:D #.-.]]^$$UCBA?>===;988542210--+*)((((&%&%&$#   `hhkWWY,,,544STTTUU555''5srADGݤ֦ئئ٦ץ׶yyzt22=///-..HII$$UCA@====;88663221/,,,*((&%&%$#$!    aZZ[MMM##$nnn-,,Bk|-.J TXbļ}++H*+I--C++,999%%VFCA@>==<:88633210.,-**((&%&$##"    d111(((XXY~OPPi uOSdئ顱ҠѠѠѠРѴy111g 114788]``{||&&WB@=>==<8875341/--,)()('&&%##"    d455'"!431^__i xTT\x}蠰ѡҠѡҟѡӵݭikoZ 322:::VXXNPQ&&W?B@==<<;9853311/,,*(((&%$$###   d556$A@>IJK667m~44<<<<>>>mt}⁀OQS+-t344331(#I@=>==<9874331/--,*+(&&$###   e111CDCCCC433et,,0)))@@@afnejmr|õǶ쟳،twwUVUACB..:|222-+*E@=><<;8754311/--*)*('&$##"   &&O;<<777 _$$zsss000XXX9;8?BEaenҾիϚlmshhjUWXLOOAAA.-.h 333332#"T?>>=;8864541/--,*)('(%$#"    b222222}UUUIIIЗoon=>=GIJHHE52.78Cihhppoiqϟsxcm}gjnDFJACFXYTYYWppqwxx[]]WXX**+ hv334''Y?>>=;8865541/.,*)*(('$##"   oh UCCCբlif^YU`aaQRSSRQTTRRRPTUQ`a]dd`bb`\et_bdxvpomhiijWWWZYVhjhlkfHJIHII--.htn?===<8876641/.,)(*))&$##     +++BBBשpqqhiihjjcffbddcdded_cc^ous{.00,++556i@>=<<9976641/--+**('&$%$"  ++HcccƵijģ玐>?@---..AFA?=<<;887641/--,**(&'%&$#!   }}ڈӨIIK**3 @??<<<9876510/--,+(')&$##!  LNNZ[\*D:0q啖DDE+++p\\G@??<<<9876631/--,**()&$$#"  iklZ[[4N%B'E =fz턆:;;000p?=?==;8754631/--,**()&$%$#   SVU٬F`$A'C(E!? <:Zo󈋊:;:000q@>=<=;8765531/--+**()&$###   Id ;/J;$A)E3mζ;;;444n@>>==;8766531/.,+,*()&$###   ONQ~h}v|+G/I^AAA,,,333|?>?>>;88766310/-,**(((&%###    JJL삕cz˗gfg((( !i sB@?=<=;97664210-,***()'&$##!   447༼CBB111eBA@>==<:8775210--,**()(&%$#    \99:ֲz{{677+++333CB@?=<=;98774210.,+*(()'&%#!    c J##Yĩyz{wxyMMNG""j((SDB@>=>=;98775311/--,*()'&&$"    &&>zzzzzzvvv}}~vvvxxxuvvcdeQRR8982325548:8TUVstuQQS/&&PFBA@>>=<;9876531/---,*(*('&$#"     **J%%<%%?+++******+++FHHKMM($" $#/--//.-,++++(((++<BA@>>=<<:766641/.--+*)*('&$##!   33333333333333333333333333333333333333333300<?EB@>>>=;888764110-,****(&&&$#!   EBA?>>=<:98764210--+,*)(''&$#!    DBA@>>=;;;8754310--,,*)('&&$#"    DBA@>>><:;8765410--+,*))('&#$"    EAAA?>>=<:8776410/--,*(*(&&#%$    nEB@?>>=<<:8656410/--,*)*(&'&$#    EBA?>>>=<:87664110--,+**('(&##    FEAAA?>>=<:87654110--,+**('(&## !    DBAA?>>=<:8765410/--,***(''%$# !   \\GCBA?>>>=;98764210---,**)('&$%#    DB@>>>=<:88753110--.,*)(((%#$$    BA?===<;98763111/,,-+)('''$""" @=;:99866532/--+*''(&$$$#"   ȀpW><5@ D09;>2>9 70?8A8 2 MFTMS Sans Serif XI#A P8=2OKPd P ;>38G5A:89 48A:P %6><5@ 70?8A8ʐ}("    !!" +%Courier NewPfF " ", P2( 0H5 8<OPX| P2$ E-mailPX$| P  " +   !!"P: "0@8D=K9 ?;0= !@>: 8A?>;=5=8O 70:070 USD RUB PG -:>=>< A - 4204F0BL G5BK@5 @01>G8E G0A0 $14 8;8 800 @C1. PQ 1KG=K9 A - 2>A5<=04F0BL @01>G8E G0A>2 20 1200 P[ KAB@K9 A - 425=04F0BL @01>G8E G0AI2 26 1500 Pe -:AB@0 A - 420 @01>G8E G0A0 34 2000P 3@P 3Px  '.P 1. >=AC;LB0F88 >?;0G820NBAO 4>?>;=8B5;L=> 8AE>4O 87 AB>8- P <>AB8 G0A0, 2:;NG0O =5?>;=>3>, $10 8;8 600 @C1.P 2. "0@8D "-:AB@5==K9" B@51C5B ?@5420@8B5;L=>3> A>3;0A>20=8OP B5E=8G5A:>9 2>7<>6=>AB8 53> 8A?>;=5=8O.P 3. 01>G8<8 G0A0<8 AG8B05BAO 8=B5@20; A 8 4> 22 G0A>2 ?> P A@54=552@>?59A:><C 2@5<5=8. Ȁ p><5@ 70?8A8 MFTMS Sans Serif P A !PN"2"OKXZB #P BF.$878G5A:89 48A:P D+><5@ 70?8A8 MFTP8d%0@0<5B@K 28@BC0;L=>3> 48A:0P eM *LBA =0G0;0 48A:0 X[b5 'P uN ,><5@ :;0AB5@0 $MFT X[s5 (P I- 07<5@ :;0AB5@0 X[5)2 /?#!"",  " +  "#, !  BOOT !" #Courier NewP"%!%+ + / !'"P|%1. 0G0;> 28B@C0;L=>3> 48A:0 P1~ &%LBA 04@5A 703@C7>G=>3> A5:B>@0 X- '%X0% ",P+Q (%"8? D09;>2>9 A8AB5<K X+ )%MFT X+% *%FAT-32 X+( +%FAT-16P6i ,% 07<5@ :;0AB5@0 2 A5:B>@0E(P6- -%P6- .%(P6- /%PDM 0% 575@2=KE A5:B>@>2 (PD- 1%(PD- 2%PQU 3% 07<5@ FAT 2 A5:B>@0E(PQ- 4%(PQ- 5%P_M 6%><5@ :;0A5B@0 ROOT(P_- 7%PmQ 8%'8A;> M;5<5=B>2 ROOT(Pn- 9%P|M :%><5@ :;0AB5@0 $MFT(Pz- ;%Pd<%2. AE>4=K9 D878G5A:89 48A:P(%P- N% !'"  ' "&+ MFT(P- O%Pc %!""!"P #T Q% P % !" # ",   "X"Z%#! !" #&PNa$" ! ++   !", P: $ P: $ P: $ P: $ P: $ P: $ P: $ P: $PPb$123 PPc$123 PPd$123 PPe$123 PPf$123 PPg$123 PPh$123 PPi$123 " /#!"",  " +  "#, !  $MFTCourier NewP %!%+ + / !'"P $%1. 0G0;L=K9 04@5A 3;02=>9 D09;>2>9 B51;8FK MFTP %LBA 04@5A MFT =0 D878G5A:>< 48A:5 X2 O%P-G% ",P8o<%2. AE>4=K9 D878G5A:89 48A: HDP =% !'"+  " +  "#, !P &%3. LBA =0G0;0 28@BC0;L=>3> 48A:0 =0 HD(P2 '%P %4. 07<5@ :;0AB5@0 2 A5:B>@0EP1 -%P %5. ;0AB5@ =0G0;0 ;02=>9 D09;>2>9 B01;8FK MFT(P1 ;%Pa %'! !""!"P Z Q% P % !" # ",   "XX%#! !" #&PNC$" ! ++   !", P:M $ P:W $ P:a $ P:k $ P:u $ P: $ P: $ P: $PPMb$123 PPWc$123 PPad$123 PPke$123 PPuf$123 PPg$123 PPh$123 PPi$123 ) 3U",  " +  "#, !  ! FILE RECORDCourier NewP %!%+ + / !'"P % X- [%P. l<%2. AE>4=K9 D878G5A:89 48A:P % !'"+  " +  "#, !P %3. 0G0;> 28@BC0;L=>3> 48A:0 (BOOT A5:B>@)(P- '%P %4. 0G0;L=K9 04@5A B01;8FK MFT(P- O%P %5. 07<5@ :;0AB5@0 2 A5:B>@0E(P- -%P ,a %!""!"P8Z Q% P+ % !" # ",   "X7V%#! !" #&P 8%6. 803=>AB8:0 MB0?>2 2KG8A;5=8O ?0@0<5B@>2 28@BC0;L=>3> 48A:0P]%"5:AB 1P^%"5:AB 2P_%"5:AB 3P`%"5:AB 4P a%"5:AB 5Pc%"5:AB 6P2S% ",Pe%1. LBA 70?8A8 FILE RecordPN9$" ! ++   !", P:C $ P:M $ P:W $ P:a $ P:k $ P:u $ P: $ P: $PPCb$123 PPMc$123 PPWd$123 PPae$123 PPkf$123 PPug$123 PPh$123 PPi$123 < /b#!"",  " +  "#, !Courier NewP% " +  #' !"   "#, !P %0G0;> 28@BC0;L=>3> 48A:0 P % P % P F% P G%P %&8;8=4@ X9" !%P] "%>;>2:0 X{ #%P $%!5:B>@ X %%P% &%LBA 04@5A X- '%P1Q (%"8? D09;>2>9 A8AB5<K X1 )%MFT X1% *%FAT-32 X1( +%FAT-16P>i ,% 07<5@ :;0AB5@0 2 A5:B>@0E(P>- -%(P>- .%(P>- /%PMM 0% 575@2=KE A5:B>@>2 (PM- 1%(PM- 2%P\U 3% 07<5@ FAT 2 A5:B>@0E(P\- 4%(P\- 5%PkM 6%><5@ :;0A5B@0 ROOT(Pk- 7%PzQ 8%'8A;> M;5<5=B>2 ROOT(Pz- 9%PM :%><5@ :;0AB5@0 $MFT(P- ;%Po<% " + $'!% !P4=%"8? 48A:0 <:>ABL &8;8=4@>2 >@>65: !5:B>@>2 07<.A5:. P$ >%HD0 5AB:89 1234,5 1 123456 255 63 1024 P$ ?%HD1 5AB:89 1234,5 1 123456 255 63 1024 P$ @%HD2 5AB:89 1234,5 1 123456 255 63 1024 P$ A%HD3 5AB:89 1234,5 1 123456 255 63 1024 P$ B%HD4 5AB:89 1234,5 1 123456 255 63 1024 P$ C%HD5 5AB:89 1234,5 1 123456 255 63 1024 P$ D%HD6 5AB:89 1234,5 1 123456 255 63 1024 P$ E%HD7 5AB:89 1234,5 1 123456 255 63 1024P$$ ",  " + !   !# ' "&+ MFTP H%&8;8=4@ X4" I%PX J%>;>2:0 Xv K%P L%!5:B>@ X M%P% N%LBA 04@5A X- O%P8a '! !""!"P DT Q% Pj8  !"   "# -" $ !!"+XsC$d%!5:B>@XC$b%;0AB5@XC$X%! MFTXC$%0B0;>38 $ &/  &Courier NewPH2l OKP m PIn ! +   HDDPiFo " "&P(dp <55ABAO ;8F5=789 2A53> - P q 55P(er 7 =8E ?@82O70=> : HDD -P s 55P(V t 12345678901234567890Pi(Q ~ 1234567890123456789P2V u .....................Pi2Q  1234567890123456789P<V v 12345678901234567890Pi<Q 1234567890123456789PFV w 12345678901234567890PiFQ 1234567890123456789PPV x 12345678901234567890PiPQ 1234567890123456789PZV y 12345678901234567890PiZQ 1234567890123456789PdV z 12345678901234567890PidQ 1234567890123456789PnV { 12345678901234567890PinQ 1234567890123456789PxV | 12345678901234567890PixQ 1234567890123456789PV } 12345678901234567890PiQ 1234567890123456789  " +  ( &Courier NewP , +  ,"PZ 0: : 0< >1@0I0BLAOPn P#W 0H M;5:B@>==K9 04@5APn P YI '! & #+% ! Pa  48= 48A:....... . !" Pl  48= 48A: ........ 9 70 48A: Py~  20 48A:0......... 8 70 48A: P}  OBL 48A:>2....... 7 70 48A: P|  5AOBL 48A:>2..... 5 70 48A:PYrI  / !" PqEURPk  P  PRUBP  8;8Pbl  ?>A;5 ?>4B25@645=8O >?;0BKPO " ",  !  &. Pnl 2>5 ACB>:... 15A?;0B=> Pzk 12 @01>G8E G0A>2 ..+10 Pi "@8 @01>G8E G0A0 ..+15 PTz( "/ !"!", &Pr  Pa ("@51C5BAO A>3;0A>20=85 2>7<>6=>AB8 8A?>;=5=8O)P 4" 5A?;0B=0O ;8F5=78O ?@54>AB02;O5BAO 2 1;03>B2>@8B5;L=KE F5;OE 8 2A5< 65;0NI8<, 2KA:065H8 :>=AB@C:B82=K5< 70<5G0=8O 8 ?@54;>65=8O ?> C;CGH5=8N ?@>3@0<<K, 0 B0:65 2K?>;=82H8< 8 ?@54AB0282H8< @57C;LB0BK A2>53> B5AB8@>20=8O.ȀjjrFomsoftDataRecovery MS Sans SerifP*ID licenseP9P 6! P*LoginP9(P 7!P= Password!P9;P 5!P/Y< 4!Continue@Ȁjj[ " + &MS Sans SerifPN! 07<5@ 1;>:0 A5B>@>2 Pt  !P)V! 07<5@ 3@C??K A5:B>@>2 Pt' !P1B< !#AB0=>28BL K1>@ =0G0;L=>3> 04@5A0 D878G5A:>3> A5:B>@0Courier NewP5] " ! ++   !", Pf  1 Pq  2 P|  3 P  4 P  5 P  6 P  7 P  8P9f P9q P9| P9 P9 P9 P9 P: P !4@5A A5:B>@0 2 D>@<0B5 LBA PV1 P.( ! A5:B>@0XX< PQp0@0<5B@K D878G5A:8E 48A:>2P<A53> A5:B>@>2 1234567890123 P#  P9 P + 4@5A A5:B>@0 2 8=B5@?@5B0F88 F8;8=4@-3>;>2:0-A5:B>@P8# &8;8=4@ P<8( Ph8 >;>2:0 P8 P8 !5:B>@ P8  K1>@ D878G5A:>3> 48A:0 A :>?859 B01;8FK GPTCourier NewP5 " ! ++   !", P  1 P(  2 P3  3 P>  4 PI  5 PT  6 P_  7 Pk  8P9 P9( P93 P9> P9I P9T P9_ P:k XX<OKPp0@0<5B@K D878G5A:8E 48A:>2GPSCN S C 0i Xj $U #X ( & ' % !W "V q_ r` sa tb uc vd we xd {i j  k Ds Wt Uu 8A:8<5NI85AO D878G5A:85 8 ;>38G5A:85 48A:85;5=85 D878G5A:8E 48A:>2 =0 ;>38G5A:85 @0745;K!:@KBL 45;5=85 =0 ;>38G5A:85 48A:85@=CBL 45;5=85 =0 ;>38G5A:85 48A:05@5703@C78BL K:;NG8BL >AAB0=>2;5=85 ! ACI5AB2CNI53> ;>38G5A:>3> 48A:09! >BD>@<0B8@>20==>3> 48A:0 NTFS! 28@BC0;L=>3> 48A:0, A<>45;8@>20==>3> ?>:5> 40==K< 703@C7>A=>3> A5:B>@06> 40==K< 70?8A0 $MFT7> 40==K< 70?8A8 FILE Record;- F5?>G:0< 70?8A59 FILE Record<03@C78BL @57C;LB0B @5:>=AB@C:F888$09;>2 F FF8D@>2KE D>B>3@0D89:0?8AL A5:B>@>2 A 48A:0 2 D09;803=>AB8:0=0;87 A>AB>O=8O D09;>2KE AB@C:BC@ NTFS 8 FAT@>A<>B@@>A<>B@ A5:B>@=>3> ?@>AB@0=AB20$878G5A:89 A5:B>@ >38G5A:89 A5:B>@ >38G5A:89 :;0AB5@ ! 70?8A8 MFT !5:B>@ >B:;NG5==>3> @0745;0 ;0AB5@ >?8O B01;8FK GPT 5@5<5I5=85 2 A5:B>@=>< ?@>AB@0=AB25U  =0G0;> 48A:0X  :>=5F 4BA:0 ?5@54 =0 A5:B>@ 0704 =0 A5:B>@ ?5@54 =0 3@C??C A5:B>@>2 0704 =0 3@C??C A5:B>@>2V ?5@54 =0 1;>: A5:B>@>2W 0704 =0 1;>: A5:B>@$>@<0B 8=B5@?@540F88 >B>1@0605<KE 40==KE_ HEX D>@<0B F2` FILE Record F3a 3;02;5=85 FAT F4b "01;8F0 FAT F5c 03@C7>G=K9 A5:B>@ FAT F6d "01;8F0 ?0@B8F89 F7e 03@C7>G=K9 A5:B>@ NTFS F8;>=8@>20=85#AB0=>28BL @07@5H5=85 70?8A8 =0 48A:#40;8BL @07@5H5=85 70?8A8 =0 48A:>?8@>20BL CG0AB>: A5:B>@>2 =0 4@C3>9 48A:G8AB:0a 1=C;5=85 2A5E A5:B>@>2 D878G5A:>3> 48A:0b 1=C;5=85 =570=OBKE A5:B>@>2 ;>38G5A:>3> 48A:0>A: A:0BL ?> <0A:5 87 D09;0 A:0BL ?> :>=B5:ABC 87 D09;0 A:0BL ?> :>=B5:ABC A :;0280BC@K8AB0=F8>==0O ?><>IL. 0?CA: A50=A0 48AB0=F8>==>9 :><?LNB5@=>9 ?><>I8/ "5E=>;>38O >:070=8O CA;C3 :><?LNB5@=>9 ?><>I8+ 5A?;0B=K9 0=0;87 @57C;LB0B>2 4803=>AB8:8 2 Fomsoft >;=>5 >?8A0=85 ?@>3@0<<K Fomsoft Data recovery8F5=78O !>AB>O=85 8F5=788, 0:07 ;8F5=78>==>9 ?@>3@0<<K =0 >?@545;5==>5 G8A;> 48A:>2Lang English RussianȀpn !"  !"  /!" MS Sans SerifXR2OK X9A P3 ~!%+ !P7\C:20 ;>38G5A:>3> 48A:0:PP -t90G0;L=K5 xxxxxxxxP8. .PC. .PN. .PY. .P/UB>1@078BL xxxxxxxP>87 P>C7 P>N7 P>Y7 Ȁp !"  !"  /!" MS Sans SerifPh29OK POA :P( 2=!%+  !P/R@><5@ 65AB:>3> 48A:0 P;P0*gA><5@ >B:;NG5==>3> @0745;0 P(<P Ct9>0G0;L=K5 xxxxxxxxPN. B.PY. C.Pd. D.Po. E.PEU?B>1@078BL xxxxxxxP>N7 FP>Y7 GP>d7 HP>o7 I# R Times New RomanPDSysTreeView32PbXESysListView32Pq8BK1@0BL 2A5P6q8C>30A8BL 2A5XqwA  ' 'Pq@ !   + !!"/P#" s#40;5==K5Pn#4 t!CI5AB2CNI85P,P 1Zu$09;>2 =0945=> 2A53>Pn12F111P12G112P ;Zv1I89 @07<5@ D09;>2 (M1)Pn;2H121P;2I122PIP OZw7 =8E >B>1@0=>PnO2J211PO2K212P YZx1I89 @07<5@ D09;>2 (M1)PnY2L221PY2M222PeP kgyB<5G5=> 4;O 2>AAB0=>2;5=8OPnk2N311Pk2O312P uZz1I89 @07<5@ D09;>2 (M1)Pnu2P321Pu2Q322P 1;0ABL =0 48A:5 70=OB0O D09;0<8 40==KEP {4@5A ?5@2>3> D878G5A:>3> A5:B>@0P |4@5A ?>A;54=53> 70=OB>3> A5:B>@0P 2T111P2U111PcP};O 2>AAB0=>2;5=8O ;N1>3> D09;0 :;8:=8B5 ?@02>9 :=>?:>9 <KH:8 ?> 53> =08<5=>20=8N, >= 1C45B 70?8A0= 2 ?0?:C, >B:C40 70?CA:0;0AL ?@>3@0<<0 FomsoftDataRecovery.4 !"  $,"  "  #+% $ Courier NewP P$8;LB@ ?>8A:0 D09;>2 ?> @0AH8@5=8O< P >Microsoft OffocePx Microsoft Word (*.doc)P!x Microsoft Word (*.rtf)P+x Microsoft Excel (*.xls)P5x Microsoft Access (*.mdb)P?x Microsoft PowerPoint (*.ppt)P N'@E82=K5 D09;KPVx $09;K 0@E82>2 (*.arj)P`x $09;K 0@E82>2 (*.rar)Pjx $09;K 0@E82>2 (*.zip)P v%>GB>2K5 D09;KPx Outlook Express (*.dbx)Px Microsoft Outlook (*.pst)P U$09;K ?@8;>65=89Px Adobe Photoshop (*.psd)P!x Adobe Illustrator (*.ai )P+x CorelDRAW (*.cdr)P5x AitoCAD (*.dwg)P?x ArchiCAD (*.pla)PIx Adobe Acrobat (*.pdf)PSx PGP (*.pgd)Pd7 0AH8@5=8O ?>;L7>20B5;OPoZ 0H5 @0AH8@5=85 1Po PyZ 0H5 @0AH8@5=85 2Py PZ 0H5 @0AH8@5=85 3P PZ 0H5 @0AH8@5=85 4P P! *$09;K 3@0D8G5A:8E D>@<0B>2P&x @0D8G5A:85 D09;K (*.gif)P&!x @0D8G5A:85 D09;K (*.tif)P&+x @0D8G5A:85 D09;K (*.jpg)P!>+C;LB8<5489=K5 D09;KP&Gx 845> (*.avi)P&Qx C7K:0 (*.mp3)P&[x 2C:>2K5 D09;K (*.waw)P!n- @>D5AA8>=0;L=K5 F8D@>2K5P&vG -D>B>3@0D88P&x $>B>3@0D88 Nikon (*.nef)P&x $>B>3@0D88 Canon (*.cr2)P-  B:;NG8BL D8;LB@0F8N D09;>2 ?> @0AH8@5=8N, 8A:0BL 2A5Px  :@><5 A8AB5<=KE D29;>2 P!].C:20 ;838G5A:>3> 48A:0P!"8A: A D09;>2>9 A8AB5<>9 Ps A:0BL 0:BC0;L=K5 D09;KPq A:0BL C40;5==K5 D09;KP !>74020BL 0=0;8B8G5A:89 TXT-D09;PX6 @8<5=8BL> .!"  $,"  ! +%   "& !" ! Courier NewP $8;LB@ ?>8A:0 D09;>2 ?> @0AH8@5=8O< P >Microsoft OffocePx Microsoft Word (*.doc)P!x Microsoft Word (*.rtf)P+x Microsoft Excel (*.xls)P5x Microsoft Access (*.mdb)P?x Microsoft PowerPoint (*.ppt)P N' @E82=K5 D09;KPVx $09;K 0@E82>2 (*.arj)P`x $09;K 0@E82>2 (*.rar)Pjx $09;K 0@E82>2 (*.zip)P v% >GB>2K5 D09;KPx Outlook Express (*.dbx)Px Microsoft Outlook (*.pst)P U $09;K ?@8;>65=89Px Adobe Photoshop (*.psd)P!x Adobe Illustrator (*.ai )P+x CorelDRAW (*.cdr)P5x AitoCAD (*.dwg)P?x ArchiCAD (*.pla)PIx Adobe Acrobat (*.pdf)PSx PGP (*.pgd)Pd7 0AH8@5=8O ?>;L7>20B5;OPoZ 0H5 @0AH8@5=85 1Po PyZ 0H5 @0AH8@5=85 2Py PZ 0H5 @0AH8@5=85 3P PZ 0H5 @0AH8@5=85 4P P! * $09;K 3@0D8G5A:8E D>@<0B>2P&x @0D8G5A:85 D09;K (*.gif)P&!x @0D8G5A:85 D09;K (*.tif)P&+x @0D8G5A:85 D09;K (*.jpg)P!>+ C;LB8<5489=K5 D09;KP&Gx 845> (*.avi)P&Qx C7K:0 (*.mp3)P&[x 2C:>2K5 D09;K (*.waw)P!n- @>D5AA8>=0;L=K5 F8D@>2K5P&vG D>B>3@0D88P&x $>B>3@0D88 Nikon (*.nef)P&x $>B>3@0D88 Canon (*.cr2)P- B:;NG8BL D8;LB@0F8N D09;>2 ?> @0AH8@5=8N, 8A:0BL 2A5Px :@><5 A8AB5<=KE D29;>2 P> $8;LB@ ?>8A:0 D09;>2 ?> =0G0;L=K< A8<2>;0< =08<5=>20=8OP} A:0BL D09;K, =0G8=0NI85AO =0 P P} A:0BL D09;K, =0G8=0NI85AO =0 P P} A:0BL D09;K, =0G8=0NI85AO =0 P Pk B:;NG8BL D8;LB@0F8N ?> =08<5=>20=8N D09;>2, 8A:0BL 2A5Ps A:0BL 0:BC0;L=K5 D09;KP q A:0BL C40;5==K5 D09;KP !>74020BL 0=0;8B8G5A:89 TXT-D09;P- 8A: A D09;>2>9 A8AB5<>9 P } >@O4:>2K9 =><5@ 65AB:>3> 48A:0 P P  >@O4:>2K9 =><5@ >B:;NG5==>3> @0745;0 P Pt6 @8<5=8BL:  !"  $,"  " , !/  #/ $ Courier NewPk-@8<5=8BLP$8;LB@ ?>8A:0 D09;>2 ?> @0AH8@5=8O< P > Microsoft OffocePx Microsoft Word (*.doc)P!x Microsoft Word (*.rtf)P+x Microsoft Excel (*.xls)P5x Microsoft Access (*.mdb)P?x Microsoft PowerPoint (*.ppt)P N'!@E82=K5 D09;KPVx $09;K 0@E82>2 (*.arj)P`x $09;K 0@E82>2 (*.rar)Pjx $09;K 0@E82>2 (*.zip)P v%">GB>2K5 D09;KPx Outlook Express (*.dbx)Px Microsoft Outlook (*.pst)P U#$09;K ?@8;>65=89Px Adobe Photoshop (*.psd)P!x Adobe Illustrator (*.ai )P+x CorelDRAW (*.cdr)P5x AitoCAD (*.dwg)P?x ArchiCAD (*.pla)PIx Adobe Acrobat (*.pdf)PSx PGP (*.pgd)Pd7$ 0AH8@5=8O ?>;L7>20B5;OPoZ 0H5 @0AH8@5=85 1Pm PyZ 0H5 @0AH8@5=85 2Pw PZ 0H5 @0AH8@5=85 3P PZ 0H5 @0AH8@5=85 4P P! *%$09;K 3@0D8G5A:8E D>@<0B>2P&x @0D8G5A:85 D09;K (*.gif)P&!x @0D8G5A:85 D09;K (*.tif)P&+x @0D8G5A:85 D09;K (*.jpg)P!>+&C;LB8<5489=K5 D09;KP&Gx 845> (*.avi)P&Qx C7K:0 (*.mp3)P&[x 2C:>2K5 D09;K (*.wav)P!n-'@>D5AA8>=0;L=K5 F8D@>2K5P&vG *D>B>3@0D88P&x $>B>3@0D88 Nikon (*.nef)P&x $>B>3@0D88 Canon (*.cr2)P>($8;LB@ ?>8A:0 D09;>2 ?> =0G0;L=K< A8<>;0< =08<5=>20=8OP} A:0BL D09;K, =0G8=0NI85AO =0 P P} A:0BL D09;K, =0G8=0NI85AO =0 P P} A:0BL D09;K, =0G8=0NI85AO =0 P Pi B:;NG8BL D8;LB@0F8N ?> =08<5=>20=8N D09;>2P)$8;LB@0F8O C40;5==KE/ACI5AB2CNI8E D09;>2 PgV A:0BL ACI5AB28NI85PU A:0BL C40;5==K5P+3=>@8@>20BL F5?>G:8 70?8A59Pa,B01;8FK MFT 4;8=>9 <5=55 P9 -1 !"  $,"  "  #+% $ Courier NewP$8;LB@ ?>8A:0 D09;>2 ?> @0AH8@5=8O< P >Microsoft OffocePx Microsoft Word (*.doc)P!x Microsoft Word (*.rtf)P+x Microsoft Excel (*.xls)P5x Microsoft Access (*.mdb)P?x Microsoft PowerPoint (*.ppt)P N'@E82=K5 D09;KPVx $09;K 0@E82>2 (*.arj)P`x $09;K 0@E82>2 (*.rar)Pjx $09;K 0@E82>2 (*.zip)P v%>GB>2K5 D09;KPx Outlook Express (*.dbx)Px Microsoft Outlook (*.pst)P U$09;K ?@8;>65=89Px Adobe Photoshop (*.psd)P!x Adobe Illustrator (*.ai )P+x CorelDRAW (*.cdr)P5x AitoCAD (*.dwg)P?x ArchiCAD (*.pla)PIx Adobe Acrobat (*.pdf)PSx PGP (*.pgd)Pd7 0AH8@5=8O ?>;L7>20B5;OPoZ 0H5 @0AH8@5=85 1Po PyZ 0H5 @0AH8@5=85 2Py PZ 0H5 @0AH8@5=85 3P PZ 0H5 @0AH8@5=85 4P P! *$09;K 3@0D8G5A:8E D>@<0B>2P&x @0D8G5A:85 D09;K (*.gif)P&!x @0D8G5A:85 D09;K (*.tif)P&+x @0D8G5A:85 D09;K (*.jpg)P!>+C;LB8<5489=K5 D09;KP&Gx 845> (*.avi)P&Qx C7K:0 (*.mp3)P&[x 2C:>2K5 D09;K (*.waw)P!n- @>D5AA8>=0;L=K5 F8D@>2K5P&vG -D>B>3@0D88P&x $>B>3@0D88 Nikon (*.nef)P&x $>B>3@0D88 Canon (*.cr2)P-  B:;NG8BL D8;LB@0F8N D09;>2 ?> @0AH8@5=8N, 8A:0BL 2A5Px  :@><5 A8AB5<=KE D29;>2 Ps A:0BL 0:BC0;L=K5 D09;KPq A:0BL C40;5==K5 D09;KP !>74020BL 0=0;8B8G5A:89 TXT-D09;Ps6 @8<5=8BLʐ}( $ !!"+Courier NewP APBmsctls_progress32Progress1P 6P 6SP|65SP <l _$09;K 8 ?0?:8P~<0 `!CI5AB2CNI85P<% a#40;5==K5P Je b$09;>2 =0945=> 2A53>PJ. C.PJ. D.PVf c7 =8E >B>1@0=>PV. E.PV. F.Pbf d0?:8 (:0B0;>38)Pb. G.Pb. H.PM_@@5:@0B8BL =5<54;5==>Pode1I89 @07<5@ D09;>2 (M1)Po. I.Po. J.P i P|df 07<5@ >B>1@0==KE D09;>2 P|. K.P|. L.P j48B5 >:>=G0=8O ?@>F5AA>2 @5:=AB@C:F88 45@520 :0B0;>3>2. ʐ}("  (/  &!!Courier NewP UPVmsctls_progress32Progress1P\v_W@5:@0B8BL =5<54;5==>P 4g"  (/  &P Bh@5<O >1@01>B:8 7028A8B >B G8A;0 >BD8;LB@>20==KE D09;>2.P Ni>65B ?>B@51>20BLAO :0: <8;;8A5:C=4K, B0: 8 =5A:>;L:> <8=CB.ʐ}(| '  !  !   FOMSOFTCourier NewP sPtmsctls_progress32Progress1PJc_u@5:@0B8BL =5<54;5==>P 4v"  (/  &P BwK?>;=O5BAO >B?@02:0 D09;0 FindFoto201.bin =0 A5@25@P Ix;01>@0B>@88 2>AAB0=>2;5=8O 40==KE FomSoft. ʐ }( Courier NewP &# P#msctls_progress32Progress1P =9 #!:>@>ABL 1.P I5 # P=9 #AB0;>ALPI5 # PS=: #!G8B0=>PVI5 # PVg2#AB0=>28BLȀ )!45;0BL 48A: 4;O Windows =5@07<5G5==K<MS Sans SerifP2OKP.2Cancel Px  1 P3x  2 PRx  3 Psx  4 Px  5 Px  6 Px  7 Px  8P b0==0O >?5@0F8O 70:;NG05BAO 2 87<5=5=88 703@C7>G=>3> A5:B>@0 (MBR). = <>- 48D8F8@C5BAO ?> AB0=40@BC GUID Partition Table (GPT) B0:8< >1@07><, GB> 4;O >?5@0F8>==>9 A8AB5<K Windows 48A: >AB05BAO 70=OBK<, => =58A?>;L7C5<K<. P m!" !, " +  !",  '+